Transcription Factor

Accessions: 5x6m_B (3D-footprint 20231221)
Names: Dwarfin-C, Dwf-C, MAD homolog 5, Mothers against decapentaplegic homolog 5, Mothers against DPP homolog 5, mSmad5, SMAD 5, SMAD family member 5, SMAD5_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P97454
Length: 122
Pfam Domains: 20-120 MH1 domain
Sequence:
(in bold interface residues)
1 PAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSL 60
61 DGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVE 120
121 SP
Interface Residues: 61, 63, 65, 70
3D-footprint Homologues: 6fzs_A, 5nm9_A, 5od6_A, 6h3r_A, 5mey_A
Binding Motifs: 5x6m_AB TGCCGnnAGTCT
Binding Sites: 5x6m_C
5x6m_D
Publications: Chai N, Li WX, Wang J, Wang ZX, Yang SM, Wu JW. Structural basis for the Smad5 MH1 domain to recognize different DNA sequences. Nucleic Acids Res 43:9051-64 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.