Transcription Factor

Accessions: 4jcy_A (3D-footprint 20231221), 4jcy_B (3D-footprint 20231221)
Names: Csp231I C protein, Q32WH4_9ENTR
Organisms: Citrobacter sp. RFL231
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q32WH4
Length: 92
Pfam Domains: 4-69 Helix-turn-helix domain
4-61 Helix-turn-helix domain
6-64 Helix-turn-helix
Sequence:
(in bold interface residues)
1 MLIRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMANRLAKVLKIP 60
61 VSYLYTPEDDLAQIILTWNELNEQERKRINFY
Interface Residues: 17, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 40, 41, 42, 43
3D-footprint Homologues: 2r1j_L, 3u3w_B, 4jcy_A, 5f55_A
Binding Motifs: 4jcy_A ytAAGA
4jcy_AB CTAAGAnnnTnTTAG
Binding Sites: 4jcy_C
4jcy_D
Publications: Shevtsov M.B, Streeter S.D, Thresh S.J, Swiderska A, McGeehan J.E, Kneale G.G. Structural analysis of DNA binding by C.Csp231I, a member of a novel class of R-M controller proteins regulating gene expression. Acta crystallographica. Section D, Biological crystallography 71:398-407 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.