Transcription Factor
Accessions: | 4jcy_A (3D-footprint 20231221), 4jcy_B (3D-footprint 20231221) |
Names: | Csp231I C protein, Q32WH4_9ENTR |
Organisms: | Citrobacter sp. RFL231 |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q32WH4 |
Length: | 92 |
Pfam Domains: | 4-61 Helix-turn-helix domain 4-69 Helix-turn-helix domain 6-64 Helix-turn-helix |
Sequence: (in bold interface residues) | 1 MLIRRLKDARLRAGISQEKLGVLAGIDEASASARMNQYEKGKHAPDFEMANRLAKVLKIP 60 61 VSYLYTPEDDLAQIILTWNELNEQERKRINFY |
Interface Residues: | 17, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 40, 41, 42, 43 |
3D-footprint Homologues: | 2r1j_L, 3u3w_B, 4jcy_A, 5f55_A |
Binding Motifs: | 4jcy_A ytAAGA 4jcy_AB CTAAGAnnnTnTTAG |
Binding Sites: | 4jcy_C 4jcy_D |
Publications: | Shevtsov M.B, Streeter S.D, Thresh S.J, Swiderska A, McGeehan J.E, Kneale G.G. Structural analysis of DNA binding by C.Csp231I, a member of a novel class of R-M controller proteins regulating gene expression. Acta crystallographica. Section D, Biological crystallography 71:398-407 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.