Transcription Factor
Accessions: | 2r5y_A (3D-footprint 20231221) |
Names: | Homeotic protein Sex combs reduced, SCR_DROME |
Organisms: | Drosophila melanogaster |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P09077 |
Length: | 73 |
Pfam Domains: | 15-70 Homeobox domain |
Sequence: (in bold interface residues) | 1 GKKNPPQIYPWMKRVQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIW 60 61 FQNRRMKWKKEHK |
Interface Residues: | 9, 14, 15, 16, 17, 55, 56, 58, 59, 62, 63, 66, 67, 70 |
3D-footprint Homologues: | 3a01_E, 6a8r_A, 1puf_A, 3cmy_A, 5zfz_A, 1fjl_B, 3d1n_M, 4cyc_A, 2lkx_A, 1nk2_P, 2ld5_A, 2h1k_B, 1jgg_B, 7q3o_C, 5jlw_D, 3lnq_A, 6es3_K, 4xrs_G, 2hdd_A, 1au7_A, 3rkq_B, 2r5y_A, 6m3d_C, 5flv_I, 2hos_A, 1b72_A, 5zjt_E, 1ig7_A, 7psx_B, 5hod_A, 1e3o_C, 1le8_A, 7xrc_C, 2xsd_C, 1o4x_A, 1du0_A, 4qtr_D, 1puf_B, 8g87_X, 1zq3_P, 3l1p_A |
Binding Motifs: | 2r5y_A TTTAtgG 2r5y_AB TGATTTAwgG |
Binding Sites: | 2r5y_C 2r5y_D |
Publications: | Joshi R, Passner J.M, Rohs R, Jain R, Sosinsky A, Crickmore M.A, Jacob V, Aggarwal A.K, Honig B, Mann R.S. Functional specificity of a Hox protein mediated by the recognition of minor groove structure. Cell 131:530-43 (2007). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.