Transcription Factor

Accessions: 2r5y_A (3D-footprint 20231221)
Names: Homeotic protein Sex combs reduced, SCR_DROME
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P09077
Length: 73
Pfam Domains: 15-70 Homeobox domain
Sequence:
(in bold interface residues)
1 GKKNPPQIYPWMKRVQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIW 60
61 FQNRRMKWKKEHK
Interface Residues: 9, 14, 15, 16, 17, 55, 56, 58, 59, 62, 63, 66, 67, 70
3D-footprint Homologues: 3a01_E, 6a8r_A, 1puf_A, 3cmy_A, 5zfz_A, 1fjl_B, 3d1n_M, 4cyc_A, 2lkx_A, 1nk2_P, 2ld5_A, 1ig7_A, 7psx_B, 5hod_A, 2h1k_B, 1jgg_B, 7q3o_C, 5jlw_D, 3lnq_A, 6es3_K, 4xrs_G, 2hdd_A, 1au7_A, 3rkq_B, 2r5y_A, 6m3d_C, 5flv_I, 2hos_A, 1b72_A, 5zjt_E, 1e3o_C, 1le8_A, 7xrc_C, 2xsd_C, 3l1p_A, 1o4x_A, 1du0_A, 4qtr_D, 1puf_B, 8g87_X, 1zq3_P
Binding Motifs: 2r5y_A TTTAtgG
2r5y_AB TGATTTAwgG
Binding Sites: 2r5y_C
2r5y_D
Publications: Joshi R, Passner J.M, Rohs R, Jain R, Sosinsky A, Crickmore M.A, Jacob V, Aggarwal A.K, Honig B, Mann R.S. Functional specificity of a Hox protein mediated by the recognition of minor groove structure. Cell 131:530-43 (2007). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.