Transcription Factor
| Accessions: | SpoIIID (DBTBS 1.0) |
| Names: | G4P1P8_BACPN, SpoIIID |
| Organisms: | Bacillus subtilis |
| Libraries: | DBTBS 1.0 1 1 Sierro N, Makita Y, de Hoon M, Nakai K. DBTBS: a database of transcriptional regulation in Bacillus subtilis containing upstream intergenic conservation information. Nucleic acids research 36:D93-6 (2008). [Pubmed] |
| Uniprot: | G4P1P8 |
| Length: | 93 |
| Pfam Domains: | 2-82 Stage III sporulation protein D |
| Sequence: (in bold interface residues) | 1 MHDYIKERTIKIGKYIVETKKTVRVIAKEFGVSKSTVHKDLTERLPEINPDLANEVKEIL 60 61 DYHKSIRHLRGGEATKLKYKKDEILEGEPVQQS |
| Interface Residues: | 23, 24, 26, 28, 29, 30, 32, 33, 34, 36, 38, 39, 40, 41, 42, 44, 50, 53, 54, 63, 67 |
| 3D-footprint Homologues: | 5vl9_A, 7cuh_A, 4hja_A, 7ubl_A, 7qxb_P, 8i54_A, 6opm_B |
| Binding Motifs: | SpoIIID wGGACArGC |
| Binding Sites: | bofA_2 bofA_3 cotC_4 cotD_4 cotD_5 cotD_6 cotJA_2 cotX_4 spoIID_2 spoIIIAA_2 spoIVCA_2 spoIVCA_3 spoIVCB_5 spoIVCB_6 spoIVCB_7 spoVD_2 spoVD_3 spoVE_3 spoVE_4 |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.