Transcription Factor

Accessions: ZNF435_full (HumanTF 1.0)
Names: Zinc finger and SCAN domain-containing protein 16, Zinc finger protein 392, Zinc finger protein 435, ZNF435, ZSC16_HUMAN
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q9H4T2
Notes: Ensembl ID: ENSG00000196812; Full protein sequence; TF family: znfC2H2; Clone source: hORFeome
Length: 349
Pfam Domains: 36-129 SCAN domain
236-258 Zinc finger, C2H2 type
236-258 C2H2-type zinc finger
236-258 C2H2-type zinc finger
250-273 Zinc-finger double domain
263-279 C2H2-type zinc finger
264-286 Zinc finger, C2H2 type
264-286 C2H2-type zinc finger
282-302 Zinc-finger double domain
291-312 C2H2-type zinc finger
292-314 Zinc finger, C2H2 type
292-314 C2H2-type zinc finger
307-329 Zinc-finger double domain
319-340 C2H2-type zinc finger
320-342 Zinc finger, C2H2 type
320-342 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MTTALEPEDQKGLLIIKAEDHYWGQDSSSQKCSPHRRELYRQHFRKLCYQDAPGPREALT 60
61 QLWELCRQWLRPECHTKEQILDLLVLEQFLSILPKDLQAWVRAHHPETGEEAVTVLEDLE 120
121 RELDEPGKQVPGNSERRDILMDKLAPLGRPYESLTVQLHPKKTQLEQEAGKPQRNGDKTR 180
181 TKNEELFQKEDMPKDKEFLGEINDRLNKDTPQHPKSKDIIENEGRSEWQQRERRRYKCDE 240
241 CGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHRVHTGVKPYKCKECGKD 300
301 FSGRTGLIQHQRIHTGEKPYECDECGRPFRVSSALIRHQRIHTANKLY*
Interface Residues: 221, 225, 236, 246, 247, 248, 249, 250, 252, 253, 254, 255, 256, 257, 259, 274, 275, 276, 277, 278, 279, 280, 281, 282, 285, 289, 302, 303, 304, 305, 306, 307, 308, 309, 312, 330, 331, 332, 333, 334, 336, 337
3D-footprint Homologues: 7w1m_H, 2kmk_A, 8cuc_F, 1tf3_A, 7y3l_A, 7n5w_A, 3uk3_C, 1f2i_J, 5k5i_A, 8ssu_A, 5v3j_F, 2gli_A, 8gn3_A, 6blw_A, 5kkq_D, 1tf6_A, 6u9q_A, 5ei9_F, 8ssq_A, 1mey_C, 5und_A, 7eyi_G, 4m9v_C, 8h9h_G, 7y3m_I, 2i13_A, 6e94_A, 7ysf_A, 6wmi_A, 2jpa_A, 1ubd_C, 6jnm_A, 2drp_D, 6ml4_A, 1g2f_F, 5yel_A, 4x9j_A, 7txc_E, 5kl3_A, 2wbs_A, 5yj3_D, 2lt7_A, 6a57_A, 1llm_D
Binding Motifs: ZNF435_full agTGTTAACAGAACACCt
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.