Transcription Factor

Accessions: 5d8k_B (3D-footprint 20241219)
Names: Heat shock factor protein 2, Heat shock transcription factor 2, HSF 2, HSF2_HUMAN, HSTF 2
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q03933
Length: 106
Pfam Domains: 4-105 HSF-type DNA-binding
Sequence:
(in bold interface residues)
1 HMPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQL 60
61 NMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKV
Interface Residues: 55, 58, 59, 61, 62
3D-footprint Homologues: 3hts_B, 7dci_A
Binding Motifs: 5d8k_B gTTc
Binding Sites: 5d8k_A
Publications: Jaeger AM, Pemble CW 4th, Sistonen L, Thiele DJ. Structures of HSF2 reveal mechanisms for differential regulation of human heat-shock factors. Nat Struct Mol Biol 23:147-54 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.