Transcription Factor

						

			
Accessions: 1ckt_A (3D-footprint 20231221)

			
Names: Amphoterin, Heparin-binding protein p30, HIGH MOBILITY GROUP 1 PROTEIN, High mobility group protein 1, High mobility group protein B1, HMG-1, HMGB1_RAT
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P63159
Length: 71
Pfam Domains:      1-68 Domain of unknown function (DUF1898)
     6-71 HMG (high mobility group) box
Sequence: 
(in bold interface residues)		   1 KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKAD   60
  61 KARYEREMKTY
Interface Residues: 4, 6, 7, 9, 10, 11, 12, 13, 17, 19, 25, 26, 29, 30, 31, 32, 35
3D-footprint Homologues: 1qrv_A, 2gzk_A, 6jrp_D, 1j5n_A, 3tmm_A, 7m5w_A, 3tq6_B, 1o4x_B, 3u2b_C, 1ckt_A
Binding Motifs: 1ckt_A gtCC
Binding Sites: 1ckt_C
1ckt_B
			
Publications: Ohndorf U.M, Rould M.A, He Q, Pabo C.O, Lippard S.J. Basis for recognition of cisplatin-modified DNA by high-mobility-group proteins. Nature 399:708-12 (1999). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.