Transcription Factor

Accessions: ALX4_TF1 (HumanTF2 1.0), ALX4 (HT-SELEX2 May2017)
Names: ALX4, ALX4_HUMAN, ENSG00000052850
Organisms: Homo sapiens
Libraries: HumanTF2 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q9H161
Notes: Ensembl ID: ENSG00000052850; Construct type: TF1(SBP); TF family: Homeodomain; Clone source: Jolma et al. 2013, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 133
Pfam Domains: 45-101 Homeobox domain
Sequence:
(in bold interface residues)
1 DTVGMDSSYLSVKEAGVKGPQDRASSDLPSPLEKADSESNKGKKRRNRTTFTSYQLEELE 60
61 KVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYE 120
121 LPLLTRAENYAQI
Interface Residues: 44, 45, 46, 47, 48, 86, 87, 89, 90, 93, 94, 96, 97, 98, 101
3D-footprint Homologues: 4j19_B, 3cmy_A, 1puf_A, 8ejp_B, 3d1n_M, 5zfz_A, 1fjl_B, 8pmf_A, 1ig7_A, 6a8r_A, 1jgg_B, 6m3d_C, 3lnq_A, 1nk2_P, 1zq3_P, 2lkx_A, 2ld5_A, 2hdd_A, 8ik5_C, 7psx_B, 5jlw_D, 4cyc_A, 2r5y_A, 6es3_K, 4xrs_G, 2hos_A, 8osb_E, 7q3o_C, 1au7_A, 1puf_B, 8eml_B, 5flv_I, 1b72_A, 5zjt_E, 3a01_E, 5hod_A, 3rkq_B, 9b8u_A, 1e3o_C, 1le8_A, 2xsd_C, 7xrc_C, 4xrm_B, 4qtr_D, 8g87_X, 6wig_A, 1o4x_A, 8bx1_A, 1du0_A
Binding Motifs: ALX4_EOMES skyGctAAytwwwktTvrCACmt
ALX4_TBX21_1 rgGTGykAATwawmrtysrCAsykm
ALX4_TBX21_2 AGGTGytAATwa
TEAD4_ALX4_1 GGAATGytAamytAATTa
TEAD4_ALX4_2 rCATwcCkyshTAATyrrATTA
ALX4_3 cyAATTAm
ALX4_methyl_1 cyAATTAm
ALX4_methyl_2 mdCrTtAa
Publications: Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.