Transcription Factor
Accessions: | ALX4_TF1 (HumanTF2 1.0), ALX4 (HT-SELEX2 May2017) |
Names: | ALX4, ALX4_HUMAN, ENSG00000052850 |
Organisms: | Homo sapiens |
Libraries: | HumanTF2 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Uniprot: | Q9H161 |
Notes: | Ensembl ID: ENSG00000052850; Construct type: TF1(SBP); TF family: Homeodomain; Clone source: Jolma et al. 2013, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
Length: | 133 |
Pfam Domains: | 45-101 Homeobox domain |
Sequence: (in bold interface residues) | 1 DTVGMDSSYLSVKEAGVKGPQDRASSDLPSPLEKADSESNKGKKRRNRTTFTSYQLEELE 60 61 KVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYE 120 121 LPLLTRAENYAQI |
Interface Residues: | 44, 45, 46, 47, 48, 86, 87, 89, 90, 93, 94, 97, 98, 101 |
3D-footprint Homologues: | 4j19_B, 1ig7_A, 5zfz_A, 2h1k_B, 1puf_A, 3cmy_A, 1fjl_B, 6a8r_A, 3d1n_M, 1zq3_P, 1jgg_B, 6m3d_C, 3lnq_A, 2lkx_A, 1nk2_P, 2ld5_A, 6es3_K, 4xrs_G, 3l1p_A, 7q3o_C, 3a01_E, 5flv_I, 5zjt_E, 2hdd_A, 1au7_A, 5hod_A, 3rkq_B, 2r5y_A, 1puf_B, 2hos_A, 7psx_B, 1b72_A, 5jlw_D, 4cyc_A, 2xsd_C, 7xrc_C, 1e3o_C, 1le8_A, 1o4x_A, 1du0_A, 4qtr_D, 6wig_A, 8g87_X, 4xrm_B |
Binding Motifs: | ALX4_EOMES skyGctAAytwwwktTvrCACmt ALX4_TBX21_1 rgGTGykAATwawmrtysrCAsykm ALX4_TBX21_2 AGGTGytAATwa TEAD4_ALX4_1 GGAATGytAamytAATTa TEAD4_ALX4_2 rCATwcCkyshTAATyrrATTA ALX4_3 cyAATTAm ALX4_methyl_1 cyAATTAm ALX4_methyl_2 mdCrTtAa |
Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.