Transcription Factor
| Accessions: | RAP2.6 (ArabidopsisPBM 20140210), T000596_1.02 (CISBP 1.02), Q7G1L2 (JASPAR 2024), T05799 (AthalianaCistrome v4_May2016) |
| Names: | RAP2.6, T000596_1.02;, Ethylene-responsive transcription factor RAP2-6, Protein RELATED TO APETALA2 6, RAP26_ARATH, AT1G43160, T05799; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | ArabidopsisPBM 20140210 1, CISBP 1.02 2, JASPAR 2024 3, AthalianaCistrome v4_May2016 4 1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed] 2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 4 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Notes: | AP2/EREBP (ERF), experiment type:PBM, family:AP2, ecotype:Col-0, experiment type: DAP-seq, family:AP2-EREBP |
| Length: | 192 |
| Pfam Domains: | 59-109 AP2 domain |
| Sequence: (in bold interface residues) | 1 MVSMLTNVVSGETEPSASATWTMGHKREREEFSLPPQPLITGSAVTKECESSMSLERPKK 60 61 YRGVRQRPWGKWAAEIRDPHKATRVWLGTFETAEAAARAYDAAALRFRGSKAKLNFPENV 120 121 GTQTIQRNSHFLQNSMQPSLTYIDQCPTLLSYSRCMEQQQPLVGMLQPTEEENHFFEKPW 180 181 TEYDQYNYSSFG |
| Interface Residues: | 65, 67, 69, 73, 75, 77, 84, 86 |
| 3D-footprint Homologues: | 1gcc_A, 5wx9_A, 7wq5_A |
| Binding Motifs: | RAP2.6 gSCGCCGCCr RAP2.6_2 mrGCCGCmaw RAP2.6_3 cATGACGGCw M0010_1.02 syGCcGkc MA1052.1 SCGCCGCC M0077 / MA1221.1 tkrCGGCGGmGghgg |
| Binding Sites: | MA1221.1.4 MA1221.1.10 MA1221.1.7 MA1221.1.13 / MA1221.1.8 MA1221.1.15 / MA1221.1.18 MA1221.1.20 MA1221.1.14 MA1221.1.19 MA1221.1.16 MA1221.1.17 MA1221.1.5 MA1221.1.2 / MA1221.1.3 MA1221.1.12 MA1221.1.1 MA1221.1.11 MA1221.1.6 MA1221.1.9 |
| Publications: | Hao D., Ohme-Takagi M., Sarai A. Unique mode of GCC box recognition by the DNA-binding domain of ethylene-responsive element-binding factor (ERF domain) in plant. J. Biol. Chem. 273:26857-26861 (1998). [Pubmed] Magnani E, Sjölander K, Hake S. From endonucleases to transcription factors: evolution of the AP2 DNA binding domain in plants. Plant Cell 16:2265-77 (2004). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.