Transcription Factor

						

			
Accessions: NKX3-1 (HT-SELEX2 May2017)

			
Names: ENSG00000167034, NKX3-1
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 134
Pfam Domains:    44-100 Homeobox domain
Sequence: 
(in bold interface residues)		   1 AAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELER   60
  61 KFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALK  120
 121 EEAFSRASLVSVYN
Interface Residues: 23, 27, 43, 44, 45, 46, 47, 85, 86, 88, 89, 92, 93, 95, 96, 97, 100
3D-footprint Homologues: 1e3o_C, 3a01_E, 8pmf_A, 3d1n_M, 1nk2_P, 1fjl_B, 6a8r_A, 1ig7_A, 5zfz_A, 1puf_A, 3cmy_A, 8ejp_B, 1zq3_P, 3lnq_A, 2lkx_A, 1jgg_B, 2ld5_A, 8eml_B, 1b72_A, 5jlw_D, 6es3_K, 4xrs_G, 3rkq_B, 7psx_B, 5flv_I, 2hdd_A, 9b8u_A, 5zjt_E, 4cyc_A, 2r5y_A, 8osb_E, 7q3o_C, 5hod_A, 2hos_A, 8ik5_C, 2xsd_C, 8pi8_B, 1le8_A, 7xrc_C, 2h8r_B, 1au7_A, 4qtr_D, 1o4x_A, 8g87_X, 1le8_B, 8bx1_A, 1du0_A, 1mnm_C, 1puf_B, 1k61_B
Binding Motifs: NKX3-1_3 mcCACTTAac
NKX3-1_methyl_1 acCACTTAac
NKX3-1_methyl_2 stcgTTAa
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.