Transcription Factor

						

			
Accessions: 5k98_B (3D-footprint 20231221), 5k98_P (3D-footprint 20231221)

			
Names: Antitoxin HipB, HIPB_ECOLI
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: M9IJX7
Length: 71
Pfam Domains:      9-64 Helix-turn-helix domain
     9-62 Helix-turn-helix domain
    13-64 Helix-turn-helix domain
    15-66 Helix-turn-helix
    19-64 Cro/C1-type HTH DNA-binding domain
Sequence: 
(in bold interface residues)		   1 FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQS   60
  61 LELSMTLCDTK
Interface Residues: 25, 26, 35, 36, 37, 38, 40, 41, 44, 47, 48
3D-footprint Homologues: 3oqm_C, 1per_L, 3cro_R, 3zkc_A, 5k98_B, 3dnv_B, 4z5h_A, 5gpc_B, 4lln_I
Binding Motifs: 5k98_BP TATCCCnnnnnnGGGATA
5k98_P GGGaTa
Binding Sites: 5k98_E
5k98_T
			
Publications: Schumacher MA, Balani P, Min J, Chinnam NB, Hansen S, Vulić M, Lewis K, Brennan RG. HipBA-promoter structures reveal the basis of heritable multidrug tolerance. Nature 524:59-64 (2015). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.