Transcription Factor
| Accessions: | MEOX1 (HT-SELEX2 May2017), P50221 (JASPAR 2024) |
| Names: | ENSG00000005102, MEOX1, Homeobox protein MOX-1, MEOX1_HUMAN, Mesenchyme homeobox 1 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, JASPAR 2024 2 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 254 |
| Pfam Domains: | 172-228 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYP 60 61 DFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSS 120 121 LGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTK 180 181 EQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQ 240 241 DPEDGDSTASPSSE |
| Interface Residues: | 172, 173, 174, 175, 213, 214, 216, 217, 220, 221, 223, 224, 225, 228 |
| 3D-footprint Homologues: | 8ejp_B, 6a8r_A, 1fjl_B, 3cmy_A, 8pmf_A, 5zfz_A, 1puf_A, 1ig7_A, 3d1n_M, 3lnq_A, 1nk2_P, 1zq3_P, 2lkx_A, 6m3d_C, 1jgg_B, 2ld5_A, 7q3o_C, 6es3_K, 5hod_A, 3a01_E, 8osb_E, 5jlw_D, 3rkq_B, 8eml_B, 4xrs_G, 2hdd_A, 1b72_A, 4cyc_A, 2r5y_A, 5flv_I, 2hos_A, 9b8u_A, 5zjt_E, 4j19_B, 1puf_B, 8ik5_C, 7psx_B, 1e3o_C, 1au7_A, 1le8_A, 7xrc_C, 2xsd_C, 4qtr_D, 1k61_B, 1o4x_A, 8g87_X, 1mnm_C, 8bx1_A, 1du0_A |
| Binding Motifs: | MA0661.1 rsTAATTAmc MEOX1_3 gymATtAs MEOX1_4 vkCrTtAw MEOX1_methyl_1 gymATTAs MEOX1_methyl_2 rtCrTTAr MA0661.2 sTAATTA |
| Publications: | Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.