Transcription Factor
| Accessions: | 3n97_A (3D-footprint 20231221) |
| Names: | RNA polymerase sigma factor, SIGA_THEAQ |
| Organisms: | Thermus aquaticus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q9EZJ8 |
| Length: | 53 |
| Pfam Domains: | 2-52 Sigma-70, region 4 |
| Sequence: (in bold interface residues) | 1 SKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKLRHP |
| Interface Residues: | 25, 26, 35, 36, 37, 38, 40, 41 |
| 3D-footprint Homologues: | 3n97_A, 6ido_B, 1l1m_B, 8cyf_B |
| Binding Motifs: | 3n97_A CTTGA 3n97_ABC TCAAG |
| Binding Sites: | 3n97_M 3n97_N |
| Publications: | Lara-Gonzalez S, Dantas Machado AC, Rao S, Napoli AA, Birktoft J, Di Felice R, Rohs R, Lawson CL. The RNA Polymerase α Subunit Recognizes the DNA Shape of the Upstream Promoter Element. Biochemistry 59:4523-4532 (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.