Transcription Factor
Accessions: | 3co7_F (3D-footprint 20241219), 3coa_F (3D-footprint 20241219) |
Names: | Forkhead box protein O1, Forkhead box protein O1A, Forkhead in rhabdomyosarcoma, FOXO1_HUMAN |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q12778 |
Length: | 87 |
Pfam Domains: | 9-87 Fork head domain |
Sequence: (in bold interface residues) | 1 SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIR 60 61 HNLSLHSKFIRVQNEGTGKSSWWMLNP |
Interface Residues: | 29, 53, 54, 56, 57, 58, 60, 61, 62, 64, 65, 74, 79 |
3D-footprint Homologues: | 8vfz_O, 8bzm_E, 7vox_H, 2hdc_A, 7yzg_A, 7tdw_A, 7yz7_A, 3g73_A, 7tdx_A, 2a07_J, 7yzb_A, 6el8_A, 7vou_C, 2c6y_A, 7yze_A, 7cby_C, 8sro_B |
Binding Motifs: | 3co7_F TgtTTA 3coa_F TgTTTt |
Binding Sites: | 3coa_D 3coa_E 3co7_A 3co7_B |
Publications: | Brent M.M, Anand R, Marmorstein R. Structural basis for DNA recognition by FoxO1 and its regulation by posttranslational modification. Structure (London, England : 1993) 16:1407-16 (2008). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.