Transcription Factor

Accessions: 3co7_F (3D-footprint 20231221), 3coa_F (3D-footprint 20231221)
Names: Forkhead box protein O1, Forkhead box protein O1A, Forkhead in rhabdomyosarcoma, FOXO1_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q12778
Length: 87
Pfam Domains: 9-87 Fork head domain
Sequence:
(in bold interface residues)
1 SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIR 60
61 HNLSLHSKFIRVQNEGTGKSSWWMLNP
Interface Residues: 51, 54, 56, 57, 58, 60, 61, 62, 64, 65, 74, 79
3D-footprint Homologues: 3l2c_A, 7vox_H, 2hdc_A, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 3qrf_G
Binding Motifs: 3co7_F TgtTTA
3coa_F TgTTTt
Binding Sites: 3coa_D
3coa_E
3co7_A
3co7_B
Publications: Brent M.M, Anand R, Marmorstein R. Structural basis for DNA recognition by FoxO1 and its regulation by posttranslational modification. Structure (London, England : 1993) 16:1407-16 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.