Transcription Factor

						

			
Accessions: 1d66_A (3D-footprint 20231221), 1d66_B (3D-footprint 20231221)

			
Names: GAL4_YEAST
Organisms: Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P04386
Length: 57
Pfam Domains:      2-40 Fungal Zn(2)-Cys(6) binuclear cluster domain
    43-57 Gal4-like dimerisation domain
Sequence: 
(in bold interface residues)		   1 EQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEVESRLERL
Interface Residues: 10, 11, 12, 38, 40, 41
3D-footprint Homologues: 1hwt_C, 1pyi_A, 6gys_C, 7uik_T, 1zme_D, 1d66_B, 3coq_A
Binding Motifs: 1d66_AB CGGnnnnnnnnnntCCG
Binding Sites: 1d66_D
1d66_E
			
Publications: Marmorstein R, Carey M, Ptashne M, Harrison S.C. DNA recognition by GAL4: structure of a protein-DNA complex. Nature 356:408-14 (1992). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.