Transcription Factor
| Accessions: | 5gnj_I (3D-footprint 20231221) |
| Names: | AtbHLH6, AtMYC2, Basic helix-loop-helix protein 6, bHLH 6, bHLH transcription factor bHLH006, MYC2_ARATH, Protein JASMONATE INSENSITIVE 1, R-homologous Arabidopsis protein 1, RAP-1, rd22BP1, Transcription factor EN 38, Transcription factor MYC2, Z-box binding factor 1 protein |
| Organisms: | Arabidopsis thaliana |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q39204 |
| Length: | 75 |
| Pfam Domains: | 4-49 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 EPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEK 60 61 LQIKNQLEEVKLELA |
| Interface Residues: | 5, 6, 8, 9, 12, 13, 17, 33, 35 |
| 3D-footprint Homologues: | 7xq5_A, 4h10_A, 7rcu_E, 5gnj_I, 5v0l_A, 4zpk_A, 7ssa_L, 5i50_B, 6g1l_A, 7xi3_A, 5nj8_D, 7d8t_A, 5eyo_A, 8osl_P, 1an4_A, 5sy7_B, 7z5k_B, 4zpr_B |
| Binding Motifs: | 5gnj_GIN CaCGtGt 5gnj_I ACACG |
| Binding Sites: | 5gnj_K 5gnj_L |
| Publications: | Lian TF, Xu YP, Li LF, Su XD. Crystal Structure of Tetrameric Arabidopsis MYC2 Reveals the Mechanism of Enhanced Interaction with DNA. Cell Rep 19:1334-1342 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.