Transcription Factor
Accessions: | 4bhk_A (3D-footprint 20241219), 4bhk_B (3D-footprint 20241219) |
Names: | FLORICAULA/LEAFY HOMOLOG 1, Q94IF5_PHYPA |
Organisms: | Physcomitrella patens, Physcomitrium patens (Spreading-leaved earth moss) |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q94IF5 |
Length: | 158 |
Pfam Domains: | 2-157 Floricaula / Leafy protein |
Sequence: | PREHPFIVTEPGEPAKGKKNGLDYLFDLYEQCGKFLEEVQHIAKEKGEKCPSKVTNEVFR HAKLTGAGYINKPKMRDYVHCYALHCLDVETSNNLRKEYKERGENVGAWCQACYFPLVKL ARQNEWDIDDLFNRNDKLRIWYVPTKLRQLCHIERMKH |
Binding Motifs: | 4bhk_A GGRmGrT 4bhk_AB GGnCGACCnnnGGrCGgT |
Binding Sites: | 4bhk_W 4bhk_X |
Publications: | Sayou C, Monniaux M, Nanao M.H, Moyroud E, Brockington S.F, Thévenon E, Chahtane H, Warthmann N, Melkonian M, Zhang Y, Wong G.K, Weigel D, Parcy F, Dumas R. A promiscuous intermediate underlies the evolution of LEAFY DNA binding specificity. Science (New York, N.Y.) 343:645-8 (2014). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.