Transcription Factor
| Accessions: | ECK120005198 (RegulonDB 7.5) |
| Names: | PhoP |
| Organisms: | ECK12 |
| Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
| Notes: | Member of the two-component regulatory system phoQ/phoP involved in adaptation to low Mg2+ environments and the control of acid resistance genes; Mediates magnesium influx to the cytosol by activation of mgtA; Promotes expression of the two-component regulatory system rstA/rstB and transcription of the hemL, mgrB, nagA, slyB, vboR and yrbL genes.; two component regulatory systems (external signal); repressor; operon; activator; Transcription related; cytoplasm; two-component response regulator activity; regulation of transcription, DNA-dependent; transcription, DNA-dependent; DNA binding; two-component signal transduction system (phosphorelay); intracellular signal transduction |
| Length: | 224 |
| Pfam Domains: | 3-112 Response regulator receiver domain 146-220 Transcriptional regulatory protein, C terminal |
| Sequence: (in bold interface residues) | 1 MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEHIPDIAIVDLGLPDEDGL 60 61 SLIRRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRNS 120 121 GLASQVISLPPFQVDLSRRELSINDEVIKLTAFEYTIMETLIRNNGKVVSKDSLMLQLYP 180 181 DAELRESHTIDVLMGRLRKKIQAQYPQEVITTVRGQGYLFELR* |
| Interface Residues: | 185, 187, 188, 189, 191, 192, 193, 195, 196, 212, 213, 214 |
| 3D-footprint Homologues: | 5x5l_H, 8hig_A, 8jo2_H, 8hml_B, 5ed4_A, 7e1b_B, 2z33_A, 4kfc_B, 8uvk_B, 8hih_Q, 4nhj_A, 6lxn_A, 6jbx_A |
| Binding Motifs: | PhoP wrTTTAkswwyyGTTtA |
| Binding Sites: | ECK120011494 ECK120011498 ECK120011500 ECK120015652 ECK120015654 ECK120015656 ECK120015658 ECK120015661 ECK120015663 ECK120015665 ECK120015667 ECK120016243 ECK120016245 ECK120016247 ECK120016249 ECK120016251 ECK120016253 ECK120016255 ECK120019260 ECK120048819 ECK125108737 ECK125108740 ECK125109310 ECK125109312 ECK125109314 ECK125109317 ECK125109811 ECK125109812 ECK125134656 ECK125134658 ECK125134660 ECK125134679 |
| Publications: | Yamamoto K., Ogasawara H., Fujita N., Utsumi R., Ishihama A. Novel mode of transcription regulation of divergently overlapping promoters by PhoP, the regulator of two-component system sensing external magnesium availability. Mol Microbiol. 45(2):423-38 (2002). [Pubmed] Eguchi Y., Itou J., Yamane M., Demizu R., Yamato F., Okada A., Mori H., Kato A., Utsumi R. B1500, a small membrane protein, connects the two-component systems EvgS/EvgA and PhoQ/PhoP in Escherichia coli. Proc Natl Acad Sci U S A. 104(47):18712-7 (2007). [Pubmed] Castelli ME., Garcia Vescovi E., Soncini FC. The phosphatase activity is the target for Mg2+ regulation of the sensor protein PhoQ in Salmonella. J Biol Chem. 275(30):22948-54 (2000). [Pubmed] Bachhawat P., Stock AM. Crystal structures of the receiver domain of the response regulator PhoP from Escherichia coli in the absence and presence of the phosphoryl analog beryllofluoride. J Bacteriol. 189(16):5987-95 (2007). [Pubmed] Groisman EA., Heffron F., Solomon F. Molecular genetic analysis of the Escherichia coli phoP locus. J Bacteriol. 174(2):486-91 (1992). [Pubmed] Minagawa S., Ogasawara H., Kato A., Yamamoto K., Eguchi Y., Oshima T., Mori H., Ishihama A., Utsumi R. Identification and molecular characterization of the Mg2+ stimulon of Escherichia coli. J Bacteriol. 185(13):3696-702 (2003). [Pubmed] Kato A., Tanabe H., Utsumi R. Molecular characterization of the PhoP-PhoQ two-component system in Escherichia coli K-12: identification of extracellular Mg2+-responsive promoters. J Bacteriol. 181(17):5516-20 (1999). [Pubmed] Kasahara M., Nakata A., Shinagawa H. Molecular analysis of the Escherichia coli phoP-phoQ operon. J Bacteriol. 174(2):492-8 (1992). [Pubmed] Miyashiro T., Goulian M. Stimulus-dependent differential regulation in the Escherichia coli PhoQ PhoP system. Proc Natl Acad Sci U S A. 104(41):16305-10 (2007). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.