Transcription Factor
Accessions: | 3cbb_B (3D-footprint 20231221) |
Names: | Hepatocyte Nuclear Factor 4-alpha, DNA binding domain, HNF-4-alpha, HNF4A_HUMAN, Nuclear receptor subfamily 2 group A member 1, TCF-14, Transcription factor 14, Transcription factor HNF-4 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P41235 |
Length: | 78 |
Pfam Domains: | 2-70 Zinc finger, C4 type (two domains) |
Sequence: (in bold interface residues) | 1 ALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRL 60 61 KKCFRAGMKKEAVQNERD |
Interface Residues: | 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 53, 77 |
3D-footprint Homologues: | 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A |
Binding Motifs: | 3cbb_AB GTCCAnGGTTCA |
Binding Sites: | 3cbb_C 3cbb_D |
Publications: | Lu P, Rha G.B, Melikishvili M, Wu G, Adkins B.C, Fried M.G, Chi Y.I. Structural basis of natural promoter recognition by a unique nuclear receptor, HNF4alpha. Diabetes gene product. The Journal of biological chemistry 283:33685-97 (2008). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.