Transcription Factor

Accessions: 3cbb_B (3D-footprint 20231221)
Names: Hepatocyte Nuclear Factor 4-alpha, DNA binding domain, HNF-4-alpha, HNF4A_HUMAN, Nuclear receptor subfamily 2 group A member 1, TCF-14, Transcription factor 14, Transcription factor HNF-4
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P41235
Length: 78
Pfam Domains: 2-70 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 ALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRL 60
61 KKCFRAGMKKEAVQNERD
Interface Residues: 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 53, 77
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A
Binding Motifs: 3cbb_AB GTCCAnGGTTCA
Binding Sites: 3cbb_C
3cbb_D
Publications: Lu P, Rha G.B, Melikishvili M, Wu G, Adkins B.C, Fried M.G, Chi Y.I. Structural basis of natural promoter recognition by a unique nuclear receptor, HNF4alpha. Diabetes gene product. The Journal of biological chemistry 283:33685-97 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.