Transcription Factor
| Accessions: | Q9UK33 (JASPAR 2024) |
| Names: | LDL-induced EC protein, Zinc finger protein 580, ZN580_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q9UK33 |
| Length: | 172 |
| Pfam Domains: | 92-114 C2H2-type zinc finger 107-131 Zinc-finger double domain 120-142 Zinc finger, C2H2 type 120-142 C2H2-type zinc finger 134-159 Zinc-finger double domain 150-172 Zinc finger, C2H2 type 150-172 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANG 60 61 VPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPF 120 121 TCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH |
| Interface Residues: | 92, 102, 103, 104, 105, 106, 108, 109, 112, 130, 131, 132, 133, 134, 136, 137, 138, 141, 160, 161, 162, 163, 164, 165, 166, 167, 168, 170, 171 |
| 3D-footprint Homologues: | 2kmk_A, 1tf3_A, 7n5w_A, 6jnm_A, 3uk3_C, 8cuc_F, 7y3l_A, 8gn3_A, 4x9j_A, 2gli_A, 1f2i_J, 5kl3_A, 1tf6_A, 5ei9_F, 2jpa_A, 1g2f_F, 6ml4_A, 5v3j_F, 8ssq_A, 6blw_A, 1llm_D, 6u9q_A, 8ssu_A, 5kkq_D, 8h9h_G, 7y3m_I, 7ysf_A, 7w1m_H, 6e94_A, 2lt7_A, 6a57_A, 1ubd_C, 5yj3_D, 2wbs_A, 7txc_E, 5k5i_A, 5yel_A, 2drp_D, 4m9v_C |
| Binding Motifs: | UN0205.1 cCTACCCyyrcCTACCCy UN0206.1 yrTTATGTTAAATwrTTACChtw UN0206.2 rTTATGTTAAATwrTTACC |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.