Transcription Factor

Accessions: HES1_TF1 (HumanTF2 1.0), HES1_TF2 (HumanTF2 1.0)
Names: bHLHb39, Class B basic helix-loop-helix protein 39, Hairy and enhancer of split 1, Hairy homolog, Hairy-like protein, HES1, HES1_HUMAN, hHL, Transcription factor HES-1
Organisms: Homo sapiens
Libraries: HumanTF2 1.0 1
1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: Q14469
Notes: Ensembl ID: ENSG00000114315; Construct type: TF1(SBP); TF family: bHLH; Clone source: Megaman, Ensembl ID: ENSG00000114315; Construct type: TF2(3xFLAG); TF family: bHLH; Clone source: Jolma et al. 2013
Length: 98
Pfam Domains: 24-81 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MAVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSR 60
61 HSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGK
Interface Residues: 28, 29, 31, 32, 35, 36, 55
3D-footprint Homologues: 8ia3_B, 7d8t_A, 8hov_A, 8osl_P, 5v0l_B, 2xhb_A
Binding Motifs: HES1 ggCrCGyGcc
Publications: Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.