Transcription Factor
| Accessions: | HES1_TF1 (HumanTF2 1.0), HES1_TF2 (HumanTF2 1.0) |
| Names: | bHLHb39, Class B basic helix-loop-helix protein 39, Hairy and enhancer of split 1, Hairy homolog, Hairy-like protein, HES1, HES1_HUMAN, hHL, Transcription factor HES-1 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF2 1.0 1 1 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Uniprot: | Q14469 |
| Notes: | Ensembl ID: ENSG00000114315; Construct type: TF1(SBP); TF family: bHLH; Clone source: Megaman, Ensembl ID: ENSG00000114315; Construct type: TF2(3xFLAG); TF family: bHLH; Clone source: Jolma et al. 2013 |
| Length: | 98 |
| Pfam Domains: | 24-81 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MAVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSR 60 61 HSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGK |
| Interface Residues: | 27, 28, 29, 31, 32, 34, 35, 36, 38, 55, 57 |
| 3D-footprint Homologues: | 1an4_A, 6g1l_A, 7d8t_A, 5xvp_B, 4h10_A, 1am9_A, 8osl_P, 4ail_C, 5nj8_C |
| Binding Motifs: | HES1 ggCrCGyGcc |
| Publications: | Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.