Transcription Factor

						

			
Accessions: sqz (FlyZincFinger 1.0 )

			
Names: CG5557
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 151
Pfam Domains:      5-21 C2H2-type zinc finger
     6-28 Zinc finger, C2H2 type
     6-24 C2H2-type zinc finger
    21-45 Zinc-finger double domain
    34-55 Zinc-finger of C2H2 type
    34-56 C2H2-type zinc finger
    34-56 Zinc finger, C2H2 type
    34-56 C2H2-type zinc finger
    48-74 Zinc-finger double domain
    62-84 Zinc finger, C2H2 type
    62-84 C2H2-type zinc finger
    69-86 C2H2-type zinc finger
   92-111 C2H2-type zinc finger
   92-111 Zinc finger, C2H2 type
  122-145 C2H2-type zinc finger
  123-145 Zinc finger, C2H2 type
  123-145 C2H2-type zinc finger
  124-143 Zinc-finger of C2H2 type
Sequence: 
(in bold interface residues)		   1 DQAKPYKCGSCSKSFANSSYLSQHTRIHLGIKPYRCEICQRKFTQLSHLQQHIRTHTGDK   60
  61 PYKCRHAGCPKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFSDEMTLLEHIPKHKDSKHL  120
 121 KTHICNLCGKSYTQETYLQKHLQKHAEKAEK
Interface Residues: 6, 16, 17, 18, 19, 20, 22, 23, 24, 27, 44, 45, 46, 47, 48, 49, 50, 51, 52, 55, 74, 75, 76, 77, 78, 79, 80, 81, 85, 102, 103, 104, 105, 106, 108, 109, 113, 115, 116, 117, 118, 119, 134, 136, 137, 140
3D-footprint Homologues: 2kmk_A, 7y3l_A, 1tf3_A, 7n5w_A, 6jnm_A, 5v3j_F, 3uk3_C, 8cuc_F, 6u9q_A, 8ssu_A, 5kkq_D, 8gn3_A, 4x9j_A, 2gli_A, 1f2i_J, 5kl3_A, 5ei9_F, 2jpa_A, 1g2f_F, 8ssq_A, 7w1m_H, 5k5i_A, 4m9v_C, 8h9h_G, 6e94_A, 2lt7_A, 7y3m_I, 7ysf_A, 6a57_A, 1ubd_C, 5yel_A, 2drp_D, 5yj3_D, 1tf6_A, 7txc_E, 6ml4_A, 6blw_A, 1llm_D, 2wbs_A
Binding Motifs: sqz_SANGER_5_FBgn0010768 rvtwhAyaAAAAAAAm
sqz_SOLEXA_5_FBgn0010768 mamrmAAAAAAmasv
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.