Transcription Factor
| Accessions: | T21747 (AthalianaCistrome v4_May2016), Q96276 (JASPAR 2024) |
| Names: | AT5G40330, MYB23, T21747;, AtMYB23, Myb-related protein 23, MYB23_ARATH, Transcription factor MYB23 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | AthalianaCistrome v4_May2016 1, JASPAR 2024 2 1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: DAP-seq, family:MYB |
| Length: | 219 |
| Pfam Domains: | 14-61 Myb-like DNA-binding domain 17-76 Myb-like DNA-binding domain 67-112 Myb-like DNA-binding domain 70-115 Myb-like DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MRMTRDGKEHEYKKGLWTVEEDKILMDYVRTHGQGHWNRIAKKTGLKRCGKSCRLRWMNY 60 61 LSPNVNRGNFTDQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLGLGD 120 121 HSTAVKAACGVESPPSMALITTTSSSHQEISGGKNSTLRFDTLVDESKLKPKSKLVHATP 180 181 TDVEVAATVPNLFDTFWVLEDDFELSSLTMMDFTNGYCL |
| Interface Residues: | 14, 49, 50, 51, 52, 54, 55, 58, 59, 60, 100, 101, 102, 105, 106, 109, 110, 111 |
| 3D-footprint Homologues: | 3osg_A, 1vfc_A, 7c4r_A, 1w0t_A, 2kdz_A, 7xur_A, 6kks_A, 1mse_C, 3zqc_A, 5eyb_B, 6ldm_A |
| Binding Motifs: | M0571 dwkkTwGTTGr MA1767.1 yCAACwAmmwh MA1767.2 CAACwA |
| Publications: | Kelemen Z., Sebastian A., Xu W., Grain D., Salsac F., Avon A., Berger N., Tran J., Dubrecq B., Lurin C., Lepiniec L., Contreras-Moreira B., Dubos C. Analysis of the DNA-Binding Activities of the Arabidopsis R2R3-MYB Transcription Factor Family by One-Hybrid Experiments in Yeast. PLoS One 10, e0141044 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.