Transcription Factor
| Accessions: | TFAP2B_DBD (HumanTF 1.0), TFAP2B (HT-SELEX2 May2017) |
| Names: | activating enhancer binding protein 2 beta, B2R9E2_HUMAN, cDNA, FLJ94350, highly similar to Homo sapiens transcription factor AP-2 beta, TFAP2B, ENSG00000008196 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | B2R9E2 |
| Notes: | Ensembl ID: ENSG00000008196; DNA-binding domain sequence; TF family: AP2; Clone source: Gene synthesis, TF family: TFAP experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: TFAP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 235 |
| Pfam Domains: | 19-222 Transcription factor AP-2 |
| Sequence: (in bold interface residues) | 1 SLMMNKDGFLGGMSVNTGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLG 60 61 GVLRRAKSKNGGRSLRERLEKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYICET 120 121 EFPAKAVSEYLNRQHTDPSDLHSRKNMLLATKQLCKEFTDLLAQDRTPIGNSRPSPILEP 180 181 GIQSCLTHFSLITHGFGAPAICAALTALQNYLTEALKGMDKMFLNNTTTNRHTSG |
| Interface Residues: | 32, 66, 67 |
| 3D-footprint Homologues: | 8j0k_B |
| Binding Motifs: | TFAP2B_DBD_1 tgCCyyvrGGCa TFAP2B_DBD_2 mGCCysAGGCd TFAP2B_DBD_3 tGCCCybrGGGCa TFAP2B_2 ysCCysrGGsr TFAP2B_methyl_1 ysCCysrGGsr |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.