Transcription Factor
| Accessions: | E9Q4R5 (JASPAR 2024) |
| Names: | E9Q4R5_MOUSE |
| Organisms: | Mus musculus |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | E9Q4R5 |
| Length: | 444 |
| Pfam Domains: | 25-65 KRAB box 143-166 C2H2-type zinc finger 144-166 C2H2-type zinc finger 158-183 Zinc-finger double domain 171-183 C2H2-type zinc finger 172-194 C2H2-type zinc finger 199-219 C2H2-type zinc finger 227-248 C2H2-type zinc finger 240-263 Zinc-finger double domain 253-276 C2H2-type zinc finger 254-276 C2H2-type zinc finger 269-293 Zinc-finger double domain 281-299 C2H2-type zinc finger 282-304 Zinc finger, C2H2 type 282-304 C2H2-type zinc finger 298-321 Zinc-finger double domain 309-322 C2H2-type zinc finger 310-332 C2H2-type zinc finger 326-347 Zinc-finger double domain 337-361 C2H2-type zinc finger 338-360 Zinc finger, C2H2 type 338-361 C2H2-type zinc finger 352-377 Zinc-finger double domain 365-384 C2H2-type zinc finger 366-388 Zinc finger, C2H2 type 366-388 C2H2-type zinc finger 380-405 Zinc-finger double domain 393-411 C2H2-type zinc finger 394-416 Zinc finger, C2H2 type 394-416 C2H2-type zinc finger 411-432 Zinc-finger double domain 421-443 C2H2-type zinc finger 421-443 C2H2-type zinc finger 421-443 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MRKVRGSDTRHSAAQARRECTMASVTFEDVAVRFTQEEWTLLDPSQKILYGDVMQETYRN 60 61 LTSVGINWECWDLEAYFRSLGRNLRVQLVKRDCDLKNSDPCGETVAQPKLPECHTASQSS 120 121 LKRHTTSNSKYRPCDYQKYVKKYYECKVCDKAFTCLGSLKKHKKTHAGGKPYKCKYCEKA 180 181 FSYRHCAERHMLTHSVDRHKCVVCREAFPNAVALREHKTIHSGEIPECKECGRMFWTASS 240 241 LDMHKRLHTTEKLYECKHCGKAFMRYCSFQLHKRTHTGEKPFECKQCGKTFRHSSHVQAH 300 301 KRIHTGEKPYECMQCGKTFTSGHCARRHLGTHSGAWPYKCEVCGKAYPYVYSLRNHKKSH 360 361 NEEKLYECKQCGKAFKYISSLRNHETTHTGEKPYECKECGKAFSCSSYIQNHMRTHKRQS 420 421 YECKECGKVFSYSKSLRRHMTTHS |
| Interface Residues: | 60, 62, 64, 68, 87, 90, 93, 99, 101, 103, 132, 183, 185, 186, 189, 205, 207, 208, 209, 210, 212, 213, 216, 236, 237, 238, 239, 240, 242, 243, 245, 246, 247, 249, 264, 265, 267, 268, 271, 292, 293, 294, 295, 296, 297, 298, 299, 300, 320, 321, 322, 323, 324, 325, 326, 327, 328, 331, 334, 338, 349, 350, 351, 352, 354, 355, 359, 361, 375, 376, 377, 379, 380, 383, 387, 404, 405, 406, 407, 408, 409, 410, 411, 431, 432, 434, 435, 438 |
| 3D-footprint Homologues: | 4y0f_A, 7w1m_H, 5yel_A, 5v3j_F, 7n5w_A, 6wmi_A, 5ei9_F, 8ssq_A, 2gli_A, 8ssu_A, 6blw_A, 5kkq_D, 8h9h_G, 7eyi_G, 6a57_A, 2jpa_A, 1tf3_A, 6jnm_A, 1mey_C, 5kl3_A, 1f2i_J, 5und_A, 1g2f_F, 6ml4_A, 4x9j_A, 2i13_A, 7y3m_I, 5k5i_A, 1tf6_A, 1llm_D, 4m9v_C, 6e94_A, 3uk3_C, 2wbs_A, 2kmk_A, 7ysf_A, 2lt7_A, 1ubd_C, 8cuc_F, 7y3l_A, 6u9q_A, 7txc_E, 8gn3_A, 2drp_D, 5yj3_D |
| Binding Motifs: | UN0683.1 tkGGGCGCCAry MA2126.1 GGGCGCCA |
| Binding Sites: | MA2126.1.1 / MA2126.1.11 / MA2126.1.12 / MA2126.1.16 / MA2126.1.18 / MA2126.1.2 / MA2126.1.7 / MA2126.1.8 / MA2126.1.9 UN0683.1.1 UN0683.1.10 UN0683.1.11 UN0683.1.12 UN0683.1.13 UN0683.1.14 UN0683.1.15 UN0683.1.16 UN0683.1.17 UN0683.1.18 UN0683.1.19 UN0683.1.2 UN0683.1.20 UN0683.1.3 UN0683.1.4 UN0683.1.5 UN0683.1.6 UN0683.1.7 UN0683.1.8 UN0683.1.9 MA2126.1.10 / MA2126.1.14 / MA2126.1.17 / MA2126.1.4 / MA2126.1.5 MA2126.1.13 / MA2126.1.19 MA2126.1.15 / MA2126.1.6 MA2126.1.20 MA2126.1.3 |
| Publications: | Yang B, Fang L, Gao Q, Xu C, Xu J, Chen ZX, Wang Y, Yang P. Species-specific KRAB-ZFPs function as repressors of retroviruses by targeting PBS regions. Proc Natl Acad Sci U S A : (2022). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.