Transcription Factor

Accessions: LHX4 (HT-SELEX2 May2017)
Names: ENSG00000121454, LHX4
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Znf_LIM_Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Znf_LIM_Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 114
Pfam Domains: 30-86 Homeobox domain
52-82 Homeobox KN domain
Sequence:
(in bold interface residues)
1 EFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVRE 60
61 QLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEK
Interface Residues: 30, 31, 32, 33, 71, 72, 74, 75, 78, 79, 81, 82, 83, 86
3D-footprint Homologues: 3cmy_A, 5zfz_A, 1fjl_B, 1ig7_A, 8pop_A, 6a8r_A, 8ejp_B, 6m3d_C, 1zq3_P, 3lnq_A, 1jgg_B, 2lkx_A, 2ld5_A, 4xrs_G, 2hdd_A, 8osb_E, 1au7_A, 4cyc_A, 2r5y_A, 1puf_B, 8eml_B, 5flv_I, 3d1n_M, 2hos_A, 8pmf_A, 1b72_A, 6ryd_F, 5hod_A, 3a01_E, 2d5v_B, 8ik5_C, 5jlw_D, 3rkq_B, 9b8u_A, 1e3o_C, 1le8_A, 7q3o_C, 7xrc_C, 2xsd_C, 6es3_K, 1nk2_P, 5zjt_E, 4qtr_D, 8g87_X, 1o4x_A, 8bx1_A, 1du0_A, 4xrm_B, 7psx_B, 1puf_A
Binding Motifs: LHX4_3 kYAATYrs
LHX4_6 bTAATTAv
LHX4_methyl_1 bYAATTRv
LHX4_methyl_2 ykCrTtAm
LHX4_methyl_4 yTAATTAr
LHX4_methyl_5 ytCrTTAw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.