Transcription Factor
| Accessions: | LHX4 (HT-SELEX2 May2017) |
| Names: | ENSG00000121454, LHX4 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Znf_LIM_Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Znf_LIM_Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
| Length: | 114 |
| Pfam Domains: | 30-86 Homeobox domain 52-82 Homeobox KN domain |
| Sequence: (in bold interface residues) | 1 EFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVRE 60 61 QLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEK |
| Interface Residues: | 30, 31, 32, 33, 71, 72, 74, 75, 78, 79, 81, 82, 83, 86 |
| 3D-footprint Homologues: | 3cmy_A, 5zfz_A, 1fjl_B, 1ig7_A, 8pop_A, 6a8r_A, 8ejp_B, 6m3d_C, 1zq3_P, 3lnq_A, 1jgg_B, 2lkx_A, 2ld5_A, 4xrs_G, 2hdd_A, 8osb_E, 1au7_A, 4cyc_A, 2r5y_A, 1puf_B, 8eml_B, 5flv_I, 3d1n_M, 2hos_A, 8pmf_A, 1b72_A, 6ryd_F, 5hod_A, 3a01_E, 2d5v_B, 8ik5_C, 5jlw_D, 3rkq_B, 9b8u_A, 1e3o_C, 1le8_A, 7q3o_C, 7xrc_C, 2xsd_C, 6es3_K, 1nk2_P, 5zjt_E, 4qtr_D, 8g87_X, 1o4x_A, 8bx1_A, 1du0_A, 4xrm_B, 7psx_B, 1puf_A |
| Binding Motifs: | LHX4_3 kYAATYrs LHX4_6 bTAATTAv LHX4_methyl_1 bYAATTRv LHX4_methyl_2 ykCrTtAm LHX4_methyl_4 yTAATTAr LHX4_methyl_5 ytCrTTAw |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.