Transcription Factor
Accessions: | 3fhz_B (3D-footprint 20241219) |
Names: | Arginine repressor, ARGR_MYCTU |
Organisms: | Mycobacterium tuberculosis, strain ATCC 25618 / H37Rv |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P9WPY8 |
Length: | 161 |
Pfam Domains: | 7-76 Arginine repressor, DNA binding domain 92-159 Arginine repressor, C-terminal domain |
Sequence: | AGPEVAANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLR GADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLAS AIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR |
Binding Motifs: | 3fhz_BF TGAATcnnTAyTCA |
Publications: | Cherney L.T, Cherney M.M, Garen C.R, James M.N. The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine. Journal of molecular biology 388:85-97 (2009). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.