Transcription Factor

						

			
Accessions: 3fhz_B (3D-footprint 20241219)

			
Names: Arginine repressor, ARGR_MYCTU
Organisms: Mycobacterium tuberculosis, strain ATCC 25618 / H37Rv
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P9WPY8
Length: 161
Pfam Domains:      7-76 Arginine repressor, DNA binding domain
   92-159 Arginine repressor, C-terminal domain
Sequence: AGPEVAANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLR
GADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLAS
AIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Binding Motifs: 3fhz_BF TGAATcnnTAyTCA
			
Publications: Cherney L.T, Cherney M.M, Garen C.R, James M.N. The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine. Journal of molecular biology 388:85-97 (2009). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.