Transcription Factor
| Accessions: | MAX (SMILE-seq 1.0) |
| Names: | CSAID-binding protein, CSBP, Cytokine suppressive anti-inflammatory drug-binding protein, EC 2.7.11.24, MAP kinase 14, MAP kinase MXI2, MAP kinase p38 alpha, MAPK 14, MAX, MAX-interacting protein 2, Mitogen-activated protein kinase 14, Mitogen-activated protein kinase p38 alpha, MK14_HUMAN, SAPK2a, Stress-activated protein kinase 2a |
| Organisms: | Homo sapiens |
| Libraries: | SMILE-seq 1.0 1 1 Isakova A, Groux R, Imbeault M, Rainer P, Alpern D, Dainese R, Ambrosini G, Trono D, Bucher P, Deplancke B. SMiLE-seq identifies binding motifs of single and dimeric transcription factors. Nat Methods 14:316-322 (2017). [Pubmed] |
| Uniprot: | Q16539 |
| Notes: | TF family: bHLH |
| Length: | 159 |
| Pfam Domains: | 24-74 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR 60 61 AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN 120 121 SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEA |
| Interface Residues: | 25, 27, 28, 29, 31, 32, 35, 36, 40, 60 |
| 3D-footprint Homologues: | 1a0a_B, 7z5k_B, 1an4_A, 7ssa_L, 5i50_B, 8osl_O, 7d8t_A, 7xi3_A, 5nj8_D, 7f2f_B, 5eyo_A, 7xq5_A, 5v0l_A, 7rcu_E, 5gnj_I, 6g1l_A, 1am9_A |
| Binding Motifs: | MAX CACGTG |
| Publications: | Isakova A, Groux R, Imbeault M, Rainer P, Alpern D, Dainese R, Ambrosini G, Trono D, Bucher P, Deplancke B. SMiLE-seq identifies binding motifs of single and dimeric transcription factors. Nat Methods 14:316-322 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.