Transcription Factor

Accessions: 1bdv_B (3D-footprint 20260701)
Names: ARC FV10 REPRESSOR, RARC_BPP22
Organisms: Enterobacteria phage P22
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03050
Length: 53
Pfam Domains: 4-53 Arc-like DNA binding domain
Sequence:
(in bold interface residues)
1 MKGMSKMPQVNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA
Interface Residues: 4, 5, 9, 11, 13, 34, 35, 38
3D-footprint Homologues: 1bdt_C, 3qoq_B, 1o4x_B
Binding Motifs: 1bdv_ABCD TnTAGAAnnncTCTA
1bdv_B CTnTAnnA
Binding Sites: 1bdv_E
1bdv_F
Publications: Schildbach J.F, Karzai A.W, Raumann B.E, Sauer R.T. Origins of DNA-binding specificity: role of protein contacts with the DNA backbone. Proceedings of the National Academy of Sciences of the United States of America 96:811-7 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.