Transcription Factor

Accessions: 6hc3_A (3D-footprint 20231221), 6hc3_D (3D-footprint 20231221), 6hc3_G (3D-footprint 20231221)
Names: Mitochondrial transcription factor 1, MtTF1, mtTFA, TCF-6, TFAM_HUMAN, Transcription factor 6, Transcription factor 6-like 2, Transcription factor A, mitochondrial
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q00059
Length: 192
Pfam Domains: 8-76 HMG (high mobility group) box
8-70 Domain of unknown function (DUF1898)
112-173 Domain of unknown function (DUF1898)
113-176 HMG (high mobility group) box
Sequence:
(in bold interface residues)
1 SSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDA 60
61 YRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAY 120
121 NVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQM 180
181 IEVGRKDLLRRT
Interface Residues: 10, 13, 15, 16, 19, 23, 34, 35, 36, 39, 97, 98, 99, 101, 104, 105, 115, 120, 121, 124, 128, 136, 137, 140
3D-footprint Homologues: 4y60_C, 1o4x_B, 3tmm_A, 6jrp_D, 1qrv_A, 2gzk_A, 3u2b_C, 1j5n_A, 3f27_D, 3tq6_B, 1hry_A, 1ckt_A, 7zie_A
Binding Motifs: 6hc3_ADGJ TGGTGGnnnnnnntTGTTnnnnnGGTGGnnnnnnnnTGTT
Publications: Cuppari A, Fernández-Millán P, Battistini F, Tarrés-Solé A, Lyonnais S, Iruela G, Ruiz-López E, Enciso Y, Rubio-Cosials A, Prohens R, Pons M, Alfonso C, Tóth K, Rivas G, Orozco M, Solà M. DNA specificities modulate the binding of human transcription factor A to mitochondrial DNA control region. Nucleic Acids Res 47:6519-6537 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.