Transcription Factor

Accessions: 4j19_B (3D-footprint 20231221)
Names: HMBX1_HUMAN, Homeobox telomere-binding protein 1, Homeobox-containing protein 1, Telomere-associated homeobox-containing protein 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q6NT76
Length: 76
Pfam Domains: 3-73 Homeobox domain
23-69 Homeobox KN domain
Sequence:
(in bold interface residues)
1 RRGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKV 60
61 YNWFANRRKEIKRRAN
Interface Residues: 1, 2, 3, 4, 5, 57, 58, 61, 62, 65, 66, 69, 70, 73
3D-footprint Homologues: 4j19_B, 2lkx_A, 3cmy_A, 3d1n_M, 1fjl_B, 1mnm_C, 1k61_B, 2hos_A, 1puf_B, 2h8r_B, 1ic8_B, 5zfz_A, 3rkq_B, 2hdd_A, 5jlw_D, 1le8_A, 1ig7_A, 1nk2_P, 1du0_A, 6a8r_A, 4cyc_A, 5flv_I, 6fqp_B, 3lnq_A, 6fqq_E, 4xrm_B, 3a01_E, 1b72_A, 4xrs_G
Binding Motifs: 4j19_AB GGTTAGGGTTAG
4j19_B CTAACC
Binding Sites: 4j19_C
4j19_D
Publications: Kappei D, Butter F, Benda C, Scheibe M, Draškovič I, Stevense M, Novo C.L, Basquin C, Araki M, Araki K, Krastev D.B, Kittler R, Jessberger R, Londoño-Vallejo J.A, Mann M, Buchholz F. HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment. The EMBO journal 32:1681-701 (2013). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.