Transcription Factor
Accessions: | 4j19_B (3D-footprint 20231221) |
Names: | HMBX1_HUMAN, Homeobox telomere-binding protein 1, Homeobox-containing protein 1, Telomere-associated homeobox-containing protein 1 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q6NT76 |
Length: | 76 |
Pfam Domains: | 3-73 Homeobox domain 23-69 Homeobox KN domain |
Sequence: (in bold interface residues) | 1 RRGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKV 60 61 YNWFANRRKEIKRRAN |
Interface Residues: | 1, 2, 3, 4, 5, 57, 58, 61, 62, 65, 66, 69, 70, 73 |
3D-footprint Homologues: | 4j19_B, 2lkx_A, 3cmy_A, 3d1n_M, 1fjl_B, 1mnm_C, 1k61_B, 2hos_A, 1puf_B, 2h8r_B, 1ic8_B, 5zfz_A, 3rkq_B, 2hdd_A, 5jlw_D, 1le8_A, 1ig7_A, 1nk2_P, 1du0_A, 6a8r_A, 4cyc_A, 5flv_I, 6fqp_B, 3lnq_A, 6fqq_E, 4xrm_B, 3a01_E, 1b72_A, 4xrs_G |
Binding Motifs: | 4j19_AB GGTTAGGGTTAG 4j19_B CTAACC |
Binding Sites: | 4j19_C 4j19_D |
Publications: | Kappei D, Butter F, Benda C, Scheibe M, DraÅ¡koviÄ I, Stevense M, Novo C.L, Basquin C, Araki M, Araki K, Krastev D.B, Kittler R, Jessberger R, Londoño-Vallejo J.A, Mann M, Buchholz F. HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment. The EMBO journal 32:1681-701 (2013). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.