Transcription Factor

						

			
Accessions: 4j19_B (3D-footprint 20231221)

			
Names: HMBX1_HUMAN, Homeobox telomere-binding protein 1, Homeobox-containing protein 1, Telomere-associated homeobox-containing protein 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q6NT76
Length: 76
Pfam Domains:      3-73 Homeobox domain
    23-69 Homeobox KN domain
Sequence: 
(in bold interface residues)		   1 RRGSRFTWRKECLAVMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKV   60
  61 YNWFANRRKEIKRRAN
Interface Residues: 1, 2, 3, 4, 5, 57, 58, 61, 62, 65, 66, 69, 70, 73
3D-footprint Homologues: 4j19_B, 2lkx_A, 3cmy_A, 3d1n_M, 1fjl_B, 1mnm_C, 1k61_B, 2hdd_A, 2hos_A, 1puf_B, 2h8r_B, 1ic8_B, 5zfz_A, 3rkq_B, 5jlw_D, 1ig7_A, 1le8_A, 4xrs_G, 1nk2_P, 1du0_A, 6a8r_A, 4cyc_A, 5flv_I, 6fqp_B, 3lnq_A, 6fqq_E, 4xrm_B, 3a01_E, 1b72_A
Binding Motifs: 4j19_AB GGTTAGGGTTAG
4j19_B CTAACC
Binding Sites: 4j19_C
4j19_D
			
Publications: Kappei D, Butter F, Benda C, Scheibe M, Draškovič I, Stevense M, Novo C.L, Basquin C, Araki M, Araki K, Krastev D.B, Kittler R, Jessberger R, Londoño-Vallejo J.A, Mann M, Buchholz F. HOT1 is a mammalian direct telomere repeat-binding protein contributing to telomerase recruitment. The EMBO journal 32:1681-701 (2013). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.