Transcription Factor
| Accessions: | DREB1C (Athamap 20091028), T000666_1.02 (CISBP 1.02), Q9SYS6 (JASPAR 2024), T18133 (AthalianaCistrome v4_May2016) |
| Names: | C-repeat-binding factor 2, C-repeat/dehydration-responsive element-binding factor 2, CBF2, CRT/DRE-binding factor 2, Dehydration-responsive element-binding protein 1C, DREB1C, Protein DREB1C, FTQ4, T000666_1.02;, DRE1C_ARATH, AT4G25470, T18133; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | Athamap 20091028 1, CISBP 1.02 2, JASPAR 2024 3, AthalianaCistrome v4_May2016 4 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] 2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 4 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Uniprot: | Q9SYS6 |
| Notes: | experiment type:PBM, family:AP2, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:AP2-EREBP |
| Length: | 216 |
| Pfam Domains: | 50-99 AP2 domain |
| Sequence: (in bold interface residues) | 1 MNSFSAFSEMFGSDYESPVSSGGDYSPKLATSCPKKPAGRKKFRETRHPIYRGVRQRNSG 60 61 KWVCELREPNKKTRIWLGTFQTAEMAARAHDVAAIALRGRSACLNFADSAWRLRIPESTC 120 121 AKEIQKAAAEAALNFQDEMCHMTTDAHGLDMEETLVEAIYTPEQSQDAFYMDEEAMLGMS 180 181 SLLDNMAEGMLLPSPSVQWNYNFDVEGDDDVSLWSY |
| Interface Residues: | 55, 56, 57, 58, 59, 63, 65, 67, 72, 74, 76 |
| 3D-footprint Homologues: | 5wx9_A, 1gcc_A, 7wq5_A, 7et4_D |
| Binding Motifs: | DREB1C AykrCCGACmT M0030_1.02 ATGTCGGy MA0985.1 ATGTCGGy M0068 / MA1217.1 hytyyrCCGACATmr M0027 tkATGTCGGyrra MA1670.1 wwttRCCGACAtaww MA1670.2 RCCGACAt |
| Binding Sites: | DREB1C_1 DREB1C_2 DREB1C_3 MA1670.2.11 / MA1670.2.15 / MA1670.2.16 / MA1670.2.19 / MA1670.2.20 / MA1670.2.4 / MA1670.2.8 / MA1670.2.9 MA1670.2.1 / MA1670.2.10 / MA1670.2.12 / MA1670.2.13 / MA1670.2.6 MA1670.2.5 / MA1670.2.7 MA1217.1.1 MA1217.1.10 MA1217.1.11 MA1217.1.12 MA1217.1.13 MA1217.1.14 MA1217.1.15 MA1217.1.16 MA1217.1.17 MA1217.1.18 MA1217.1.19 MA1217.1.2 MA1217.1.20 MA1217.1.3 MA1217.1.4 MA1217.1.5 MA1217.1.6 MA1217.1.7 MA1217.1.8 MA1217.1.9 MA1670.1.5 / MA1670.1.9 MA1670.1.11 / MA1670.1.7 MA1670.1.15 MA1670.1.10 / MA1670.1.16 MA1670.1.18 MA1670.1.12 / MA1670.1.19 MA1670.1.20 MA1670.1.1 / MA1670.1.2 MA1670.1.3 MA1670.1.2 / MA1670.1.4 MA1670.1.8 MA1670.1.1 MA1670.1.10 / MA1670.1.6 MA1670.1.12 / MA1670.1.8 MA1670.1.13 MA1670.1.14 / MA1670.1.9 MA1670.1.11 / MA1670.1.17 MA1670.1.5 MA1670.1.6 MA1670.1.4 / MA1670.1.7 MA1670.1.19 MA1670.1.13 MA1670.1.14 MA1670.1.15 MA1670.1.16 MA1670.1.17 MA1670.1.18 MA1670.1.20 MA1670.1.3 MA1670.2.2 MA1670.2.18 MA1670.2.14 MA1670.2.17 MA1670.2.3 |
| Publications: | Gilmour SJ, Zarka DG, Stockinger EJ, Salazar MP, Houghton JM, Thomashow MF. 1998. Low temperature regulation of the Arabidopsis CBF family of AP2 transcriptional activators as an early step in cold-induced COR gene expression. Plant J. 16:433-42. [Pubmed] Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] Magnani E, Sjölander K, Hake S. From endonucleases to transcription factors: evolution of the AP2 DNA binding domain in plants. Plant Cell 16:2265-77 (2004). [Pubmed] Medina J, Bargues M, Terol J, Pérez-Alonso M, Salinas J. The Arabidopsis CBF gene family is composed of three genes encoding AP2 domain-containing proteins whose expression Is regulated by low temperature but not by abscisic acid or dehydration. Plant Physiol 119:463-70 (1999). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.