Transcription Factor
| Accessions: | 5egb_A (3D-footprint 20231221) |
| Names: | [histone H3]-lysine36 N-trimethyltransferase PRDM9, [histone H3]-lysine4 N-trimethyltransferase PRDM9, [histone H3]-lysine9 N-trimethyltransferase PRDM9, [histone H4]-lysine20 N-methyltransferase PRDM9, [histone H4]-N-methyl-L-lysine20 N-methyltransferase PRDM9, EC 2.1.1.-, EC 2.1.1.354, EC 2.1.1.355, EC 2.1.1.359, EC 2.1.1.361, EC 2.1.1.362, Histone-lysine N-methyltransferase PRDM9, PR domain zinc finger protein 9, PR domain-containing protein 9, PRDM9_HUMAN, Protein-lysine N-methyltransferase PRDM9 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q9NQV7 |
| Length: | 111 |
| Pfam Domains: | 4-26 C2H2-type zinc finger 4-26 Zinc finger, C2H2 type 4-26 C2H2-type zinc finger 18-41 Zinc-finger double domain 32-54 C2H2-type zinc finger 32-54 C2H2-type zinc finger 32-54 Zinc finger, C2H2 type 46-69 Zinc-finger double domain 60-82 C2H2-type zinc finger 60-82 C2H2-type zinc finger 60-82 Zinc finger, C2H2 type 74-99 Zinc-finger double domain 88-110 C2H2-type zinc finger 88-110 C2H2-type zinc finger 88-110 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 EKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQRTHTGEKPY 60 61 VCRECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHT |
| Interface Residues: | 4, 14, 15, 16, 17, 18, 20, 21, 23, 24, 27, 42, 43, 44, 45, 46, 48, 49, 50, 52, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 82, 98, 99, 100, 101, 102, 104, 105 |
| 3D-footprint Homologues: | 2kmk_A, 5v3j_F, 1tf3_A, 7w1m_H, 6jnm_A, 4x9j_A, 1llm_D, 5kkq_D, 5ei9_F, 5kl3_A, 8ssq_A, 1f2i_J, 6u9q_A, 5k5i_A, 5und_A, 8ssu_A, 2gli_A, 5k5l_F, 7eyi_G, 2i13_A, 6e94_A, 7ysf_A, 6wmi_A, 2lt7_A, 1tf6_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 7n5w_A, 3uk3_C, 6blw_A, 6ml4_A, 5yel_A, 1mey_C, 2drp_D, 1g2f_F, 8h9h_G, 4m9v_C, 7y3m_I, 6a57_A, 2wbs_A, 7txc_E, 8gn3_A, 8ebt_K, 8ebx_K, 6dta_B, 5yj3_D |
| Binding Motifs: | 5egb_A tGGCTAGGGAGGC |
| Binding Sites: | 5egb_C 5egb_D |
| Publications: | Patel A, Horton JR, Wilson GG, Zhang X, Cheng X. Structural basis for human PRDM9 action at recombination hot spots. Genes Dev 30:257-65 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.