Transcription Factor

Accessions: 2e1c_A (3D-footprint 20241219)
Names: Feast/famine regulatory protein FL11, FFRP FL11, HTH-type transcriptional regulator FL11, Putative HTH-type transcriptional regulator PH1519, REG6_PYRHO
Organisms: Pyrococcus horikoshii, strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O59188
Length: 147
Pfam Domains: 2-43 AsnC-type helix-turn-helix domain
2-49 Winged helix-turn-helix DNA-binding
8-50 Bacterial regulatory protein, arsR family
68-138 AsnC family
Sequence:
(in bold interface residues)
1 PLDEIDKKIIKILQNDGKAPLREISKITGLAESTIHERIRKLRESGVIKKFTAIIDPEAL 60
61 GYSMLAFILVKVKAGKYSEVASNLAKYPEIVEVYETTGDYDMVVKIRTKNSEELNNFLDL 120
121 IGSIPGVEGTHTMIVLKTHKETTELPI
Interface Residues: 21, 31, 32, 33, 34, 36, 74, 76
3D-footprint Homologues: 2e1c_A, 6vpc_F
Binding Motifs: 2e1c_A TTTCA
Binding Sites: 2e1c_B
2e1c_D
Publications: Yokoyama K, Ishijima S.A, Koike H, Kurihara C, Shimowasa A, Kabasawa M, Kawashima T, Suzuki M. Feast/famine regulation by transcription factor FL11 for the survival of the hyperthermophilic archaeon Pyrococcus OT3. Structure (London, England : 1993) 15:1542-54 (2007). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.