Transcription Factor
| Accessions: | FOSL1 (HT-SELEX2 May2017), FOSL1_HUMAN (HOCOMOCO 10), P15407 (JASPAR 2024) |
| Names: | ENSG00000175592, FOSL1, Fos-related antigen 1, FOSL1_HUMAN, FRA-1 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 271 |
| Pfam Domains: | 103-162 bZIP transcription factor 105-157 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLG 60 61 PSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAA 120 121 KCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKE 180 181 GDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPST 240 241 PEPCASAHRKSSSSSGDPSSDPLGSPTLLAL |
| Interface Residues: | 111, 112, 115, 116, 118, 119, 122, 123, 126, 139, 176, 177, 181, 183, 193, 195 |
| 3D-footprint Homologues: | 7x5e_F, 8k8c_A, 1skn_P, 7r77_A |
| Binding Motifs: | MA0477.1 rrTGAsTCAks FOSL1_4 grTGACGTCAYc FOSL1_5 grTGAwTCAyc FOSL1_6 aATGAyrCg FOSL1_methyl_1 rATGAyRCG FOSL1_methyl_2 grTGACGTcAyc FOSL1_methyl_3 kATGAsTCAym FOSL1_HUMAN.H10MO.A|M01139 drTGACTCAty MA1128.1 kkrTGACTCAtmm MA1129.1 rTgACGTcAy MA0477.2 draTGACTCAthy MA0477.3 aTGACTCAt MA1128.2 rTGACTCAt |
| Binding Sites: | MA0477.1.1 MA0477.1.10 MA0477.1.11 MA0477.1.12 MA0477.1.13 MA0477.1.14 MA0477.1.15 MA0477.1.16 MA0477.1.17 MA0477.1.18 MA0477.1.19 MA0477.1.2 MA0477.1.20 MA0477.1.3 MA0477.1.4 MA0477.1.5 MA0477.1.6 MA0477.1.7 MA0477.1.8 MA0477.1.9 MA0477.2.1 MA0477.2.10 MA0477.2.11 MA0477.2.12 / MA0477.2.6 MA0477.2.13 MA0477.2.14 / MA0477.2.7 MA0477.2.15 MA0477.2.16 / MA0477.2.8 MA0477.2.17 MA0477.2.18 / MA0477.2.9 MA0477.2.19 MA0477.2.2 MA0477.2.10 / MA0477.2.20 MA0477.2.3 MA0477.2.4 MA0477.2.2 / MA0477.2.5 MA0477.2.6 MA0477.2.3 / MA0477.2.7 MA0477.2.4 / MA0477.2.8 MA0477.2.5 / MA0477.2.9 MA0477.2.11 MA0477.2.12 MA0477.2.13 MA0477.2.14 MA0477.2.15 MA0477.2.16 MA0477.2.17 MA0477.2.18 MA0477.2.19 MA0477.2.20 MA0477.3.1 MA0477.3.10 / MA0477.3.12 / MA0477.3.6 MA0477.3.11 MA0477.3.13 MA0477.3.14 MA0477.3.15 / MA0477.3.16 / MA0477.3.20 / MA0477.3.3 MA0477.3.17 / MA0477.3.18 MA0477.3.19 MA0477.3.2 MA0477.3.4 MA0477.3.5 / MA0477.3.7 / MA0477.3.9 MA0477.3.8 |
| Publications: | Portales-Casamar E, Kirov S, Lim J, Lithwick S, Swanson M.I, Ticoll A, Snoddy J, Wasserman W.W. PAZAR: a framework for collection and dissemination of cis-regulatory sequence annotation. Genome biology 8:R207 (2007). [Pubmed] Shaulian E, Karin M. AP-1 as a regulator of cell life and death. Nat Cell Biol : (2002). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.