Transcription Factor

Accessions: 3zhm_A (3D-footprint 20231221)
Names: CI, O48503_9CAUD
Organisms: Lactococcus phage TP901-1
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O48503
Length: 79
Pfam Domains: 27-71 Helix-turn-helix
Sequence:
(in bold interface residues)
1 KTDTSNRLKQIMAERNLKQVDILNLSIPFQKKFGIKLSKSTLSQYVNSVQSPDQNRIYLL 60
61 AKTLGVSEAWLMGRSHHHH
Interface Residues: 39, 40, 41, 43, 44, 50
3D-footprint Homologues: 3zhm_A
Binding Motifs: 3zhm_A CTGraC
Binding Sites: 3zhm_B
3zhm_C
Publications: Frandsen K.H, Rasmussen K.K, Jensen M.R, Hammer K, Pedersen M, Poulsen J.C, Arleth L, Lo Leggio L. Binding of the N-terminal domain of the lactococcal bacteriophage TP901-1 CI repressor to its target DNA: a crystallography, small angle scattering, and nuclear magnetic resonance study. Biochemistry 52:6892-904 (2013). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.