Transcription Factor

Accessions: POU2F3_DBD (HumanTF 1.0), POU5F1P1_DBD (HumanTF 1.0), POU2F3 (HT-SELEX2 May2017)
Names: Oct-11, Octamer-binding protein 11, Octamer-binding transcription factor 11, OTF-11, PO2F3_HUMAN, POU domain, class 2, transcription factor 3, POU2F3, Transcription factor PLA-1, Transcription factor Skn-1, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like, P5F1B_HUMAN, POU5F1P1, Putative POU domain, class 5, transcription factor 1B, ENSG00000137709
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q9UKI9
Notes: Ensembl ID: ENSG00000137709; DNA-binding domain sequence; TF family: homeodomain+POU; Clone source: Gene synthesis, Ensembl ID: ENSG00000137709; DNA-binding domain sequence; TF family: homeodomain+POU; Clone source: Megaman, TF family: POU experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: POU experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 195
Pfam Domains: 21-94 Pou domain - N-terminal to homeobox domain
119-175 Homeobox domain
Sequence:
(in bold interface residues)
1 LEASQHLPVPKHLPSSGGADEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGND 60
61 FSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGRKRK 120
121 KRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPV 180
181 ATPIKPPVYNSRLVS
Interface Residues: 46, 62, 63, 64, 65, 67, 68, 74, 78, 119, 120, 121, 122, 160, 161, 163, 164, 167, 168, 170, 171, 172, 175
3D-footprint Homologues: 7u0g_M, 3d1n_M, 8bx1_A, 1e3o_C, 7xrc_C, 1au7_A, 1o4x_A, 8g87_X, 2xsd_C, 8ejp_B, 5zfz_A, 3cmy_A, 8pmf_A, 5zjt_E, 1fjl_B, 6a8r_A, 1puf_A, 1ig7_A, 3lnq_A, 1zq3_P, 2lkx_A, 1nk2_P, 7q3o_C, 3a01_E, 8osb_E, 8eml_B, 2r5y_A, 5hod_A, 2hdd_A, 1b72_A, 8ik5_C, 2ld5_A, 5jlw_D, 1le8_A, 1mnm_C, 1du0_A, 6es3_K, 4xrs_G, 1jgg_B, 3rkq_B, 6fqq_E, 5flv_I, 2d5v_B, 1k61_B, 4cyc_A, 7psx_B, 4xrm_B
Binding Motifs: POU2F3_DBD_1 TATGcwAAT
POU2F3_DBD_2 wTgmATATkcAw
POU5F1P1_DBD_1 TATGywAAT
POU5F1P1_DBD_2 wTGmATATkCAw
POU2F3_3 gbAyGCTrAys
POU2F3_methyl_1 dyATGcwAATk
POU2F3_methyl_2 dyATgCGcATay
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.