Transcription Factor
| Accessions: | POU2F3_DBD (HumanTF 1.0), POU5F1P1_DBD (HumanTF 1.0), POU2F3 (HT-SELEX2 May2017) |
| Names: | Oct-11, Octamer-binding protein 11, Octamer-binding transcription factor 11, OTF-11, PO2F3_HUMAN, POU domain, class 2, transcription factor 3, POU2F3, Transcription factor PLA-1, Transcription factor Skn-1, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like, P5F1B_HUMAN, POU5F1P1, Putative POU domain, class 5, transcription factor 1B, ENSG00000137709 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q9UKI9 |
| Notes: | Ensembl ID: ENSG00000137709; DNA-binding domain sequence; TF family: homeodomain+POU; Clone source: Gene synthesis, Ensembl ID: ENSG00000137709; DNA-binding domain sequence; TF family: homeodomain+POU; Clone source: Megaman, TF family: POU experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: POU experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 195 |
| Pfam Domains: | 21-94 Pou domain - N-terminal to homeobox domain 119-175 Homeobox domain |
| Sequence: (in bold interface residues) | 1 LEASQHLPVPKHLPSSGGADEPSDLEELEKFAKTFKQRRIKLGFTQGDVGLAMGKLYGND 60 61 FSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGRKRK 120 121 KRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPV 180 181 ATPIKPPVYNSRLVS |
| Interface Residues: | 46, 62, 63, 64, 65, 67, 68, 74, 78, 119, 120, 121, 122, 160, 161, 163, 164, 167, 168, 170, 171, 172, 175 |
| 3D-footprint Homologues: | 7u0g_M, 3d1n_M, 8bx1_A, 1e3o_C, 7xrc_C, 1au7_A, 1o4x_A, 8g87_X, 2xsd_C, 8ejp_B, 5zfz_A, 3cmy_A, 8pmf_A, 5zjt_E, 1fjl_B, 6a8r_A, 1puf_A, 1ig7_A, 3lnq_A, 1zq3_P, 2lkx_A, 1nk2_P, 7q3o_C, 3a01_E, 8osb_E, 8eml_B, 2r5y_A, 5hod_A, 2hdd_A, 1b72_A, 8ik5_C, 2ld5_A, 5jlw_D, 1le8_A, 1mnm_C, 1du0_A, 6es3_K, 4xrs_G, 1jgg_B, 3rkq_B, 6fqq_E, 5flv_I, 2d5v_B, 1k61_B, 4cyc_A, 7psx_B, 4xrm_B |
| Binding Motifs: | POU2F3_DBD_1 TATGcwAAT POU2F3_DBD_2 wTgmATATkcAw POU5F1P1_DBD_1 TATGywAAT POU5F1P1_DBD_2 wTGmATATkCAw POU2F3_3 gbAyGCTrAys POU2F3_methyl_1 dyATGcwAATk POU2F3_methyl_2 dyATgCGcATay |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.