Transcription Factor
Accessions: | Q15072 (JASPAR 2024) |
Names: | Only zinc finger protein, OZF_HUMAN, Zinc finger protein 146, Zinc finger protein OZF |
Organisms: | Homo sapiens |
Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | Q15072 |
Length: | 292 |
Pfam Domains: | 8-27 Zinc-finger double domain 16-34 C2H2-type zinc finger 16-38 Zinc finger, C2H2 type 16-36 C2H2-type zinc finger 30-54 Zinc-finger double domain 43-54 C2H2-type zinc finger 44-66 C2H2-type zinc finger 44-66 Zinc finger, C2H2 type 61-82 Zinc-finger double domain 71-92 C2H2-type zinc finger 72-94 C2H2-type zinc finger 72-94 Zinc finger, C2H2 type 86-109 Zinc-finger double domain 99-122 C2H2-type zinc finger 100-122 C2H2-type zinc finger 100-122 Zinc finger, C2H2 type 114-138 Zinc-finger double domain 128-150 C2H2-type zinc finger 128-146 C2H2-type zinc finger 128-150 Zinc finger, C2H2 type 142-166 Zinc-finger double domain 156-178 Zinc finger, C2H2 type 156-178 C2H2-type zinc finger 156-166 C2H2-type zinc finger 171-194 Zinc-finger double domain 183-202 C2H2-type zinc finger 184-206 Zinc finger, C2H2 type 184-206 C2H2-type zinc finger 199-222 Zinc-finger double domain 211-234 C2H2-type zinc finger 212-234 Zinc finger, C2H2 type 212-234 C2H2-type zinc finger 226-250 Zinc-finger double domain 240-252 C2H2-type zinc finger 240-262 Zinc finger, C2H2 type 242-262 C2H2-type zinc finger 257-278 Zinc-finger double domain 268-290 C2H2-type zinc finger 268-278 C2H2-type zinc finger 268-290 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 MSHLSQQRIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECGKAFSQKQYVI 60 61 KHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIRHQR 120 121 THTGEKPFVCKECGKTFSGKSNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTG 180 181 EKPYECNECGKAFSQRTSLIVHVRIHSGDKPYECNVCGKAFSQSSSLTVHVRSHTGEKPY 240 241 GCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTH |
Interface Residues: | 27, 28, 29, 30, 32, 33, 54, 55, 57, 58, 61, 82, 83, 84, 85, 86, 88, 89, 91, 92, 93, 95, 110, 111, 112, 113, 114, 117, 138, 139, 140, 141, 142, 144, 145, 149, 166, 167, 168, 169, 170, 172, 173, 184, 194, 195, 196, 197, 198, 199, 201, 207, 221, 222, 223, 224, 225, 226, 228, 229, 230, 233, 250, 251, 252, 253, 254, 255, 256, 257, 258, 261, 278, 279, 280, 281, 282, 285 |
3D-footprint Homologues: | 2drp_D, 7w1m_H, 2lt7_A, 5ei9_F, 8ssq_A, 2gli_A, 8ssu_A, 2i13_A, 1tf3_A, 6jnm_A, 6blw_A, 5k5l_F, 1tf6_A, 5v3j_F, 5yel_A, 6a57_A, 2jpa_A, 5kl3_A, 6wmi_A, 5und_A, 6ml4_A, 6e94_A, 7ysf_A, 5kkq_D, 1ubd_C, 2kmk_A, 8cuc_F, 7n5w_A, 6u9q_A, 1f2i_J, 5k5i_A, 1g2f_F, 4x9j_A, 8h9h_G, 7eyi_G, 3uk3_C, 7y3l_A, 2wbs_A, 1mey_C, 7txc_E, 1llm_D, 4m9v_C, 7y3m_I, 5yj3_D, 8gn3_A |
Binding Motifs: | UN0316.1 GmATArTATTCCATk |
Binding Sites: | UN0316.1.1 UN0316.1.10 / UN0316.1.7 UN0316.1.11 UN0316.1.12 / UN0316.1.8 UN0316.1.13 / UN0316.1.9 UN0316.1.10 / UN0316.1.14 UN0316.1.15 UN0316.1.11 / UN0316.1.16 UN0316.1.12 / UN0316.1.17 UN0316.1.13 / UN0316.1.18 UN0316.1.15 / UN0316.1.19 UN0316.1.2 UN0316.1.20 UN0316.1.3 UN0316.1.4 UN0316.1.4 / UN0316.1.5 UN0316.1.5 / UN0316.1.6 UN0316.1.6 / UN0316.1.7 UN0316.1.8 UN0316.1.9 UN0316.1.14 UN0316.1.16 UN0316.1.17 UN0316.1.18 UN0316.1.19 UN0316.1.20 |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.