Transcription Factor
| Accessions: | OVOL1 (HT-SELEX2 May2017), OVOL1_HUMAN (HOCOMOCO 10), O14753 (JASPAR 2024) |
| Names: | ENSG00000172818, OVOL1, hOvo1, OVOL1_HUMAN, Putative transcription factor Ovo-like 1 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | O14753 |
| Notes: | TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
| Length: | 267 |
| Pfam Domains: | 118-140 C2H2-type zinc finger 118-138 Zinc finger, C2H2 type 118-138 Zinc-finger of C2H2 type 133-156 Zinc-finger double domain 147-168 C2H2-type zinc finger 148-168 Zinc finger, C2H2 type 160-185 Zinc-finger double domain 174-197 C2H2-type zinc finger 174-197 Zinc finger, C2H2 type 174-194 Zinc-finger of C2H2 type |
| Sequence: (in bold interface residues) | 1 MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLA 60 61 LNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTC 120 121 RVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCD 180 181 KAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSP 240 241 LLRKTSKKVAVALQNTVTSLLQGSPHL |
| Interface Residues: | 100, 103, 118, 128, 129, 130, 131, 132, 134, 135, 155, 156, 157, 158, 159, 160, 162, 163, 164, 184, 185, 186, 187, 188, 189, 190, 191, 192, 195, 205, 208, 211, 223, 224, 225, 226, 227, 228, 230 |
| 3D-footprint Homologues: | 7eyi_G, 6wmi_A, 2kmk_A, 6jnm_A, 1tf3_A, 7n5w_A, 1mey_C, 7w1m_H, 5und_A, 8ssu_A, 5v3j_F, 2gli_A, 1g2f_F, 6blw_A, 5kkq_D, 4x9j_A, 5kl3_A, 1ubd_C, 5ei9_F, 2jpa_A, 8ssq_A, 8h9h_G, 2lt7_A, 2i13_A, 6e94_A, 7ysf_A, 6a57_A, 8gn3_A, 3uk3_C, 8cuc_F, 7y3l_A, 2drp_D, 1f2i_J, 5k5i_A, 6ml4_A, 1tf6_A, 6u9q_A, 5yel_A, 1llm_D, 7txc_E, 2wbs_A, 4m9v_C, 7y3m_I, 5yj3_D |
| Binding Motifs: | MA1544.1 / OVOL1_2 arwACCGTTAttys OVOL1_methyl_1 arwACCGTTAttys OVOL1_HUMAN.H10MO.C|M01410 kGTAACkGW MA1544.2 rwACCGTTAt |
| Publications: | Renaud SJ, Chakraborty D, Mason CW, Rumi MA, Vivian JL, Soares MJ. OVO-like 1 regulates progenitor cell fate in human trophoblast development. Proc Natl Acad Sci U S A : (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.