Transcription Factor

Accessions: 1k78_F (3D-footprint 20260701), 3wtx_C (3D-footprint 20260701)
Names: C-ets-1 Protein, ETS1_MOUSE, p54, Protein C-ets-1, ETS1_HUMAN
Organisms: Mus musculus, Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P27577
Length: 103
Pfam Domains: 2-83 Ets-domain
Sequence:
(in bold interface residues)
1 PIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGL 60
61 RYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Interface Residues: 32, 36, 37, 40, 54, 55, 57, 58, 59, 61, 62, 76
3D-footprint Homologues: 2wbs_A, 8smh_F, 4uno_A, 8smj_F, 1dux_F, 7jsa_J, 3jtg_A, 8ee9_F, 3zp5_A, 4mhg_A, 2stt_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C, 1awc_A
Binding Motifs: 1k78_EF CGGAGAnnnGnnnnanngG
3wtx_AC GCCACATCCT
Binding Sites: 1k78_G
1k78_H
3wtx_D
3wtx_E
1k78_D
Publications: Garvie C. W., Hagman J., Wolberger C. Structural studies of Ets-1/Pax5 complex formation on DNA.. Mol. Cell 8:1267-1276 (2001). [Pubmed]

Shiina M, Hamada K, Inoue-Bungo T, Shimamura M, Uchiyama A, Baba S, Sato K, Yamamoto M, Ogata K. A Novel Allosteric Mechanism on Protein-DNA Interactions underlying the Phosphorylation-Dependent Regulation of Ets1 Target Gene Expressions. Journal of molecular biology 427:1655-69 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.