Transcription Factor

Accessions: 5hlg_E (3D-footprint 20250804)
Names: MarR family transcriptional regulator, Q5HKZ1_STAEQ
Organisms: Staphylococcus epidermidis, strain ATCC 35984 / RP62A
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q5HKZ1
Length: 137
Pfam Domains: 32-89 Sugar-specific transcriptional regulator TrmB
36-94 MarR family
37-103 Winged helix DNA-binding domain
37-94 MarR family
42-110 HxlR-like helix-turn-helix
50-91 FeoC like transcriptional regulator
60-106 Transcriptional regulator PadR-like family
Sequence:
(in bold interface residues)
1 NMKQEQMRLANQLCFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQTLNSIG 60
61 RHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSCLDE 120
121 TKYVFEELEQTLKHLIE
Interface Residues: 57, 66, 67, 68, 69, 71, 72, 73, 75, 76, 93
3D-footprint Homologues: 7el3_B, 3q5f_A, 7dvv_A, 4lln_I, 5yi2_J, 5h3r_A, 6c2s_C, 1z9c_A, 3zpl_B, 4aik_A, 5hlg_E, 4fx4_B, 5hso_A, 6jbx_A
Binding Motifs: 5hlg_E CTnaATCGc
Binding Sites: 5hlg_M / 5hlg_N
Publications: Liu G, Liu X, Xu H, Liu X, Zhou H, Huang Z, Gan J, Chen H, Lan L, Yang CG. Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR. J Am Chem Soc 139:1598-1608 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.