Transcription Factor
| Accessions: | T153992_1.02 (CISBP 1.02), Q9SAH7 (JASPAR 2024), T02603 (AthalianaCistrome v4_May2016) |
| Names: | T153992_1.02;, WRKY40, Probable WRKY transcription factor 40, WRK40_ARATH, WRKY DNA-binding protein 40, AT1G80840, T02603; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Notes: | experiment type:PBM, family:WRKY, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq |
| Length: | 302 |
| Pfam Domains: | 145-204 WRKY DNA -binding domain |
| Sequence: (in bold interface residues) | 1 MDQYSSSLVDTSLDLTIGVTRMRVEEDPPTSALVEELNRVSAENKKLSEMLTLMCDNYNV 60 61 LRKQLMEYVNKSNITERDQISPPKKRKSPAREDAFSCAVIGGVSESSSTDQDEYLCKKQR 120 121 EETVVKEKVSRVYYKTEASDTTLVVKDGYQWRKYGQKVTRDNPSPRAYFKCACAPSCSVK 180 181 KKVQRSVEDQSVLVATYEGEHNHPMPSQIDSNNGLNRHISHGGSASTPVAANRRSSLTVP 240 241 VTTVDMIESKKVTSPTSRIDFPQVQKLLVEQMASSLTKDPNFTAALAAAVTGKLYQQNHT 300 301 EK |
| Interface Residues: | 152, 153, 154, 156, 157, 168, 216, 217, 218, 220, 221, 227, 228 |
| 3D-footprint Homologues: | 6j4e_B, 6j4f_F, 6j4g_B, 6ir8_A, 7z0u_A, 8pi8_B, 2h8r_B |
| Binding Motifs: | M1681_1.02 yrGTCaas MA1085.1 yrGTCaas MA1085.2 waAGTCAAaw M0812 dwykTTGACTTttty M0835 raaAAAGTCAAmr MA1085.3 AGTCAA |
| Binding Sites: | MA1085.3.10 MA1085.2.1 MA1085.2.10 MA1085.2.11 MA1085.2.12 MA1085.2.13 MA1085.2.14 MA1085.2.15 MA1085.2.16 MA1085.2.17 MA1085.2.18 MA1085.2.19 MA1085.2.2 MA1085.2.20 MA1085.2.3 MA1085.2.4 MA1085.2.5 MA1085.2.6 MA1085.2.7 MA1085.2.8 MA1085.2.9 MA1085.3.1 MA1085.3.11 MA1085.3.12 MA1085.3.13 MA1085.3.14 / MA1085.3.16 MA1085.3.15 MA1085.3.17 MA1085.3.18 MA1085.3.19 MA1085.3.2 MA1085.3.20 MA1085.3.3 MA1085.3.4 MA1085.3.5 MA1085.3.6 MA1085.3.7 MA1085.3.8 MA1085.3.9 |
| Publications: | Yu D, Chen C, Chen Z. 2001. Evidence for an important role of WRKY DNA binding proteins in the regulation of NPR1 gene expression. Plant Cell. 13:1527-40. [Pubmed] O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.