Transcription Factor
Accessions: | 6wc2_D (3D-footprint 20241219) |
Names: | MEF2 Chimera,Myocyte-specific enhancer factor 2B,Myocyte-specific enhancer factor 2A, MEF2A_HUMAN, Serum response factor-like protein 1 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q02078 |
Length: | 93 |
Pfam Domains: | 9-58 SRF-type transcription factor (DNA-binding and dimerisation domain) |
Sequence: (in bold interface residues) | 1 GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTD 60 61 MDKVLLKYTEYSEPHESRTNTDILETLKRREHR |
Interface Residues: | 2, 14, 22, 56, 67 |
3D-footprint Homologues: | 8q9p_B, 7xuz_H, 8q9q_A, 8q9r_F, 8q9n_B, 7yq3_E |
Binding Motifs: | 6wc2_CDM GCTAnnnnnaGAAAAngC 6wc2_D caCTA |
Binding Sites: | 6wc2_G 6wc2_H |
Publications: | Lei X, Zhao J, Sagendorf JM, Rajashekar N, Xu J, Dantas Machado AC, Sen C, Rohs R, Feng P, Chen L. Crystal Structures of Ternary Complexes of MEF2 and NKX2-5 Bound to DNA Reveal a Disease Related Protein-Protein Interaction Interface. J Mol Biol 432:5499-5508 (2020). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.