Transcription Factor

Accessions: T000629_1.02 (CISBP 1.02)
Names: HRD, T000629_1.02;
Organisms: Arabidopsis thaliana
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:AP2
Length: 184
Pfam Domains: 14-64 AP2 domain
Sequence:
(in bold interface residues)
1 MQGTSKDNGGRHPLYRGVRQRKNSNKWVSEIREPRKPNRIWLGTFSTPEMAAIAYDVAAL 60
61 ALKGSQAELNFPNSVSSLPAPTSMSPADIQAAAASAAAAFGAARDAIVMANNNSQTSGVA 120
121 CMNSSYDNTNMNGFMDEDLVFDMPNVLMNMAEGMLLSPPRPTVFDAAYDADGFPGGDDYL 180
181 WNFP
Interface Residues: 8, 19, 21, 22, 23, 24, 28, 30, 32, 39, 41
3D-footprint Homologues: 5wx9_A, 1gcc_A, 7wq5_A
Binding Motifs: M0019_1.02 ytrCCGaCa
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.