Transcription Factor
| Accessions: | 2p7c_B (3D-footprint 20260701) |
| Names: | Beta-lactamase repressor protein, BLAI_BACLI, Penicillinase repressor, Regulatory protein BlaI |
| Organisms: | Bacillus licheniformis |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P06555 |
| Length: | 82 |
| Pfam Domains: | 7-80 Penicillinase repressor |
| Sequence: (in bold interface residues) | 1 MKKIPQISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHH 60 61 KEGRVFVYTPNIDESDYIEVKS |
| Interface Residues: | 26, 42, 43, 45, 46, 47, 49, 50, 54, 66, 68 |
| 3D-footprint Homologues: | 2p7c_B, 1xsd_A, 1sax_A |
| Binding Motifs: | 2p7c_B aTTACAt |
| Binding Sites: | 2p7c_A 2p7c_C |
| Publications: | Boudet J, Duval V, Van Melckebeke H, Blackledge M, Amoroso A, Joris B, Simorre J.P. Conformational and thermodynamic changes of the repressor/DNA operator complex upon monomerization shed new light on regulation mechanisms of bacterial resistance against beta-lactam antibiotics. Nucleic acids research 35:4384-95 (2007). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.