Transcription Factor

						

			
Accessions: 2p7c_B (3D-footprint 20231221)

			
Names: Beta-lactamase repressor protein, BLAI_BACLI, Penicillinase repressor, Regulatory protein BlaI
Organisms: Bacillus licheniformis
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P06555
Length: 82
Pfam Domains:      7-80 Penicillinase repressor
Sequence: 
(in bold interface residues)		   1 MKKIPQISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHH   60
  61 KEGRVFVYTPNIDESDYIEVKS
Interface Residues: 26, 42, 43, 45, 46, 47, 49, 50, 54, 66, 68
3D-footprint Homologues: 2p7c_B, 1xsd_A, 1sax_A
Binding Motifs: 2p7c_B aTTACAt
Binding Sites: 2p7c_A
2p7c_C
			
Publications: Boudet J, Duval V, Van Melckebeke H, Blackledge M, Amoroso A, Joris B, Simorre J.P. Conformational and thermodynamic changes of the repressor/DNA operator complex upon monomerization shed new light on regulation mechanisms of bacterial resistance against beta-lactam antibiotics. Nucleic acids research 35:4384-95 (2007). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.