Transcription Factor

Accessions: 2gat_A (3D-footprint 20241219), 3gat_A (3D-footprint 20241219)
Names: Eryf1, ERYTHROID TRANSCRIPTION FACTOR GATA-1, GATA-binding factor 1, GATA1_CHICK, NF-E1 DNA-binding protein, NF-E1a
Organisms: Gallus gallus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P17678
Length: 66
Pfam Domains: 7-40 GATA zinc finger
Sequence:
(in bold interface residues)
1 KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSS 60
61 KGKKRR
Interface Residues: 38, 41, 42, 43
3D-footprint Homologues: 7aud_E, 8j9v_A
Binding Motifs: 3gat_A AGaTa
2gat_A tatCT
Binding Sites: 2gat_B / 3gat_B
2gat_C / 3gat_C
Publications: Tjandra N, Omichinski J.G, Gronenborn A.M, Clore G.M, Bax A. Use of dipolar 1H-15N and 1H-13C couplings in the structure determination of magnetically oriented macromolecules in solution. Nature structural biology 4:732-8 (1997). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.