Transcription Factor
Accessions: | sna (FlyZincFinger 1.0 ) |
Names: | CG3956 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 148 |
Pfam Domains: | 5-29 C2H2-type zinc finger 5-27 Zinc finger, C2H2 type 5-25 C2H2-type zinc finger 39-62 C2H2-type zinc finger 40-62 Zinc finger, C2H2 type 40-62 C2H2-type zinc finger 54-77 Zinc-finger double domain 67-88 Zinc finger, C2H2 type 67-88 C2H2-type zinc finger 67-88 C2H2-type zinc finger 81-104 Zinc-finger double domain 94-116 Zinc finger, C2H2 type 94-116 C2H2-type zinc finger 94-116 C2H2-type zinc finger 108-133 Zinc-finger double domain 122-145 C2H2-type zinc finger 122-145 Zinc finger, C2H2 type 122-140 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 KNYRFKCDECQKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECGKLYTTIGALKMHIR 60 61 THTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVK 120 121 KYACQVCHKSFSRMSLLNKHSSSNCTIT |
Interface Residues: | 15, 16, 18, 19, 22, 37, 39, 40, 50, 51, 52, 53, 54, 56, 57, 59, 60, 63, 76, 77, 78, 79, 80, 82, 83, 84, 104, 105, 106, 107, 108, 109, 110, 111, 112, 115, 132, 133, 134, 135, 136, 137, 138, 139 |
3D-footprint Homologues: | 7w1m_H, 5v3j_F, 2i13_A, 5yel_A, 1ubd_C, 6jnm_A, 8ssq_A, 8ssu_A, 6ml4_A, 5kkq_D, 5ei9_F, 7eyi_G, 7ysf_A, 6wmi_A, 6a57_A, 2jpa_A, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 3uk3_C, 5k5i_A, 2kmk_A, 5und_A, 2gli_A, 1g2f_F, 1tf6_A, 4x9j_A, 8gn3_A, 1llm_D, 6blw_A, 2wbs_A, 6u9q_A, 1mey_C, 5kl3_A, 1f2i_J, 4m9v_C, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 5yj3_D, 5k5l_F, 7txc_E, 2drp_D |
Binding Motifs: | sna_FlyReg_FBgn0003448 smACyTGytd sna_SANGER_10_FBgn0003448 cCACCTGTym sna_SOLEXA_5_FBgn0003448 gkkgkrACAGGTGg |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.