Transcription Factor

Accessions: sna (FlyZincFinger 1.0 )
Names: CG3956
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 148
Pfam Domains: 5-29 C2H2-type zinc finger
5-27 Zinc finger, C2H2 type
5-25 C2H2-type zinc finger
39-62 C2H2-type zinc finger
40-62 Zinc finger, C2H2 type
40-62 C2H2-type zinc finger
54-77 Zinc-finger double domain
67-88 Zinc finger, C2H2 type
67-88 C2H2-type zinc finger
67-88 C2H2-type zinc finger
81-104 Zinc-finger double domain
94-116 Zinc finger, C2H2 type
94-116 C2H2-type zinc finger
94-116 C2H2-type zinc finger
108-133 Zinc-finger double domain
122-145 C2H2-type zinc finger
122-145 Zinc finger, C2H2 type
122-140 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 KNYRFKCDECQKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECGKLYTTIGALKMHIR 60
61 THTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVK 120
121 KYACQVCHKSFSRMSLLNKHSSSNCTIT
Interface Residues: 15, 16, 18, 19, 22, 37, 39, 40, 50, 51, 52, 53, 54, 56, 57, 59, 60, 63, 76, 77, 78, 79, 80, 82, 83, 84, 104, 105, 106, 107, 108, 109, 110, 111, 112, 115, 132, 133, 134, 135, 136, 137, 138, 139
3D-footprint Homologues: 7w1m_H, 5v3j_F, 2i13_A, 5yel_A, 1ubd_C, 6jnm_A, 8ssq_A, 8ssu_A, 6ml4_A, 5kkq_D, 5ei9_F, 7eyi_G, 7ysf_A, 6wmi_A, 6a57_A, 2jpa_A, 1tf3_A, 8cuc_F, 7y3l_A, 7n5w_A, 3uk3_C, 5k5i_A, 2kmk_A, 5und_A, 2gli_A, 1g2f_F, 1tf6_A, 4x9j_A, 8gn3_A, 1llm_D, 6blw_A, 2wbs_A, 6u9q_A, 1mey_C, 5kl3_A, 1f2i_J, 4m9v_C, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 5yj3_D, 5k5l_F, 7txc_E, 2drp_D
Binding Motifs: sna_FlyReg_FBgn0003448 smACyTGytd
sna_SANGER_10_FBgn0003448 cCACCTGTym
sna_SOLEXA_5_FBgn0003448 gkkgkrACAGGTGg
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.