Transcription Factor
| Accessions: | 2wbs_A (3D-footprint 20231221), 5ke7_A (3D-footprint 20231221) |
| Names: | Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor, KLF4_MOUSE, KRUEPPEL-LIKE FACTOR 4 |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q60793 |
| Length: | 87 |
| Pfam Domains: | 4-28 Zinc finger, C2H2 type 4-28 C2H2-type zinc finger 20-42 Zinc-finger double domain 34-58 Zinc finger, C2H2 type 34-58 C2H2-type zinc finger 51-75 Zinc-finger double domain 64-86 C2H2-type zinc finger 64-86 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 TATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTG 60 61 HRPFQCQKCDRAFSRSDHLALHMKRHF |
| Interface Residues: | 16, 17, 18, 19, 20, 22, 23, 25, 26, 29, 46, 47, 48, 49, 50, 52, 53, 54, 57, 67, 68, 70, 71, 74, 75, 76, 77, 78, 79, 80, 81, 82, 85 |
| 3D-footprint Homologues: | 6jnm_A, 8cuc_F, 1tf3_A, 3uk3_C, 6ml4_A, 7n5w_A, 7ysf_A, 1mey_C, 6wmi_A, 5ei9_F, 7w1m_H, 5und_A, 2kmk_A, 7eyi_G, 8ssq_A, 2gli_A, 1g2f_F, 1tf6_A, 6blw_A, 5kkq_D, 8ssu_A, 2i13_A, 1llm_D, 6u9q_A, 1ubd_C, 5kl3_A, 8h9h_G, 5v3j_F, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 2jpa_A, 5k5i_A, 7y3l_A, 2wbs_A, 2drp_D, 1f2i_J, 5yel_A, 4x9j_A, 8gn3_A, 7txc_E, 4m9v_C, 2stt_A, 4l18_B, 4lg0_B, 4bqa_A, 5yj3_D, 8gh6_A |
| Binding Motifs: | 2wbs_A gCGCCy 5ke7_A GcCAnACCTc |
| Binding Sites: | 2wbs_F 2wbs_G 5ke7_B 5ke7_C |
| Publications: | Schuetz A, Nana D, Rose C, Zocher G, Milanovic M, Koenigsmann J, Blasig R, Heinemann U, Carstanjen D. The structure of the Klf4 DNA-binding domain links to self-renewal and macrophage differentiation. Cellular and molecular life sciences : CMLS 68:3121-31 (2011). [Pubmed] Hashimoto H, Wang D, Steves AN, Jin P, Blumenthal RM, Zhang X, Cheng X. Distinctive Klf4 mutants determine preference for DNA methylation status. Nucleic Acids Res 44:10177-10185 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.