Transcription Factor
| Accessions: | 5ke9_A (3D-footprint 20231221) |
| Names: | Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor, KLF4_MOUSE, Krueppel-like factor 4 |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q60793 |
| Length: | 88 |
| Pfam Domains: | 5-29 C2H2-type zinc finger 5-29 Zinc finger, C2H2 type 21-43 Zinc-finger double domain 35-59 C2H2-type zinc finger 35-59 Zinc finger, C2H2 type 52-76 Zinc-finger double domain 65-87 Zinc finger, C2H2 type 65-87 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 RTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDPLTRHYRKHT 60 61 GHRPFQCQKCDRAFSRSDHLALHMKRHF |
| Interface Residues: | 17, 18, 19, 20, 21, 23, 24, 26, 27, 30, 47, 48, 49, 50, 51, 53, 54, 55, 58, 68, 69, 71, 72, 75, 76, 77, 78, 79, 80, 81, 82, 83, 86 |
| 3D-footprint Homologues: | 3uk3_C, 6ml4_A, 7n5w_A, 6jnm_A, 8cuc_F, 1tf3_A, 8ssu_A, 2gli_A, 1g2f_F, 1tf6_A, 6blw_A, 5kkq_D, 2i13_A, 1llm_D, 6u9q_A, 4x9j_A, 1ubd_C, 5kl3_A, 7ysf_A, 1mey_C, 6wmi_A, 5ei9_F, 8ssq_A, 7w1m_H, 5und_A, 2kmk_A, 7eyi_G, 5v3j_F, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 2jpa_A, 5k5i_A, 7y3l_A, 8gn3_A, 5yel_A, 7txc_E, 2wbs_A, 2drp_D, 1f2i_J, 4m9v_C, 2stt_A, 4bqa_A, 4l18_B, 4lg0_B, 5yj3_D |
| Binding Motifs: | 5ke9_A RGGTGTGgy |
| Binding Sites: | 5ke9_B 5ke9_C |
| Publications: | Hashimoto H, Wang D, Steves AN, Jin P, Blumenthal RM, Zhang X, Cheng X. Distinctive Klf4 mutants determine preference for DNA methylation status. Nucleic Acids Res 44:10177-10185 (2016). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.