Transcription Factor

Accessions: 5ke9_A (3D-footprint 20241219)
Names: Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor, KLF4_MOUSE, Krueppel-like factor 4
Organisms: Mus musculus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q60793
Length: 88
Pfam Domains: 5-29 Zinc finger, C2H2 type
5-29 C2H2-type zinc finger
21-43 Zinc-finger double domain
35-59 Zinc finger, C2H2 type
35-59 C2H2-type zinc finger
52-76 Zinc-finger double domain
65-87 Zinc finger, C2H2 type
65-87 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 RTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDPLTRHYRKHT 60
61 GHRPFQCQKCDRAFSRSDHLALHMKRHF
Interface Residues: 17, 18, 19, 20, 21, 23, 24, 26, 27, 30, 47, 48, 49, 50, 51, 53, 54, 58, 75, 76, 77, 78, 79, 81, 82, 86
3D-footprint Homologues: 1tf3_A, 7n5w_A, 8cuc_F, 2gli_A, 1tf6_A, 7ysf_A, 1ubd_C, 8ssq_A, 7w1m_H, 2kmk_A, 6u9q_A, 8ssu_A, 5v3j_F, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 2jpa_A, 7y3l_A, 8gn3_A, 7txc_E, 2drp_D
Binding Motifs: 5ke9_A RGGTGTGgy
Binding Sites: 5ke9_B
5ke9_C
Publications: Hashimoto H, Wang D, Steves AN, Jin P, Blumenthal RM, Zhang X, Cheng X. Distinctive Klf4 mutants determine preference for DNA methylation status. Nucleic Acids Res 44:10177-10185 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.