Transcription Factor
Accessions: | 2hdc_A (3D-footprint 20241219) |
Names: | Forkhead box protein D3, FOXD3_RAT, Fragment, Hepatocyte nuclear factor 3 forkhead homolog 2, HFH-2, HNF3/FH transcription factor genesis, TRANSCRIPTION FACTOR |
Organisms: | Rattus norvegicus |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q63245 |
Length: | 97 |
Pfam Domains: | 2-97 Fork head domain |
Sequence: (in bold interface residues) | 1 VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCF 60 61 VKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKR |
Interface Residues: | 25, 44, 45, 47, 48, 49, 51, 52, 53, 55, 56, 65, 72, 93, 97 |
3D-footprint Homologues: | 8vfz_O, 8bzm_E, 7vox_H, 2hdc_A, 7yzb_A, 6el8_A, 7vou_C, 2c6y_A, 7yze_A, 7cby_C, 7yzg_A, 7tdw_A, 7yz7_A, 3g73_A, 7tdx_A, 2a07_J, 8sro_B |
Binding Motifs: | 2hdc_A TGTTATttta |
Binding Sites: | 2hdc_B 2hdc_C |
Publications: | Jin C, Marsden I, Chen X, Liao X. Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex. Journal of molecular biology 289:683-90 (1999). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.