Transcription Factor

Accessions: 2hdc_A (3D-footprint 20250804)
Names: Forkhead box protein D3, FOXD3_RAT, Fragment, Hepatocyte nuclear factor 3 forkhead homolog 2, HFH-2, HNF3/FH transcription factor genesis, TRANSCRIPTION FACTOR
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q63245
Length: 97
Pfam Domains: 2-97 Fork head domain
Sequence:
(in bold interface residues)
1 VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCF 60
61 VKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKR
Interface Residues: 25, 44, 45, 47, 48, 49, 51, 52, 53, 55, 56, 65, 72, 93, 94, 97
3D-footprint Homologues: 8vfz_O, 8bzm_E, 7vox_H, 2hdc_A, 6el8_A, 7tdx_A, 3l2c_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 8sro_B, 3qrf_G
Binding Motifs: 2hdc_A TGTTATttta
Binding Sites: 2hdc_B
2hdc_C
Publications: Jin C, Marsden I, Chen X, Liao X. Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex. Journal of molecular biology 289:683-90 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.