Transcription Factor

						

			
Accessions: 2hdc_A (3D-footprint 20241219)

			
Names: Forkhead box protein D3, FOXD3_RAT, Fragment, Hepatocyte nuclear factor 3 forkhead homolog 2, HFH-2, HNF3/FH transcription factor genesis, TRANSCRIPTION FACTOR
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q63245
Length: 97
Pfam Domains:      2-97 Fork head domain
Sequence: 
(in bold interface residues)		   1 VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCF   60
  61 VKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKR
Interface Residues: 25, 44, 45, 47, 48, 49, 51, 52, 53, 55, 56, 65, 72, 93, 97
3D-footprint Homologues: 8vfz_O, 8bzm_E, 7vox_H, 2hdc_A, 7yzg_A, 7tdw_A, 7yz7_A, 3g73_A, 7tdx_A, 2a07_J, 7yzb_A, 6el8_A, 7vou_C, 2c6y_A, 7yze_A, 7cby_C, 8sro_B
Binding Motifs: 2hdc_A TGTTATttta
Binding Sites: 2hdc_B
2hdc_C
			
Publications: Jin C, Marsden I, Chen X, Liao X. Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex. Journal of molecular biology 289:683-90 (1999). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.